KEGG   Xiphophorus couchianus (Monterrey platyfish): 114138179Help
Entry
114138179         CDS       T05908                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00562  Inositol phosphate metabolism
xco01100  Metabolic pathways
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04115  p53 signaling pathway
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04218  Cellular senescence
xco04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114138179
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114138179
   04070 Phosphatidylinositol signaling system
    114138179
   04150 mTOR signaling pathway
    114138179
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114138179
  09143 Cell growth and death
   04115 p53 signaling pathway
    114138179
   04218 Cellular senescence
    114138179
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114138179
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xco01009]
    114138179
Enzymes [BR:xco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     114138179
    3.1.3.48  protein-tyrosine-phosphatase
     114138179
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     114138179
Protein phosphatases and associated proteins [BR:xco01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    114138179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 114138179
NCBI-ProteinID: XP_027863081
LinkDB All DBs
Position
22
AA seq 443 aa AA seqDB search
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFTEAQDALDFYGEVRTRDRKGVTIPSQRRYVYYYNY
LLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEPTPQGFKKGNWHWDPQFVV
YQLKVKIHTSNPAHTRREDKHMIFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPDESGEKMENGAVNNVESQQGAPGQGQVQVQAQPQVAETRDGCREGDRDNLILTL
TKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNSEASTSTSVTPDVSDNEPDHYRYS
DTTDSDPENEPFDEEQHTQITKV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgattataaaagaaatggtcagtcggaacaaaaggagataccaggaggacggt
tttgacttggacttaacgtatatctacccaaacattattgctatgggctttccagcagag
cgactcgaaggcgtgtacagaaacaatatagatgacgtagtacggtttttggattcaaag
cataaaaaccattacaaaatctacaacctctgcgcagaaagacactacgacgctgcaaaa
tttaattgtagagtggcccagtatcctttcgaagatcataacccccctcagctggagcta
attaagccattttgcgaagacttggaccaatggctcagcgaggacgacaatcacgtggcg
gccatccactgcaaggccggcaagggccgcaccggggtcatgatctgcgcctatctgctc
caccgcggcaagttcaccgaggcccaggatgctctcgacttctacggggaagtgaggaca
cgggacaggaagggggtgacgatcccgagccagcgccgatacgtgtactactacaactac
ctgttaaagaaccagctggagtacaagccagtggcactgctgttccacaagatggtcttc
gagactctccccatgttcagcgggggcacctgcagggacagtaccgttaaaaacaggagc
gagccgacccctcagggcttcaagaaagggaattggcattgggatccgcagtttgtcgta
taccaactcaaagtgaagattcacacttcgaacccggctcacaccagaagggaggacaag
cacatgatattcgaattcccccagccgctgcccgtctgtggcgacatcaaagtggagttc
ttccacaaacaaaataagatgatgaagaaggacaaaatgttccacttctgggtgaacaca
ttcttcattcctggaccagacgagagcggggaaaagatggagaacggggcggtgaacaac
gtggagagccagcaaggagcgccgggccagggccaggtccaggtccaggcccagccgcag
gtcgctgagaccagggacggctgcagggaaggcgacagggacaacctcatcctgacgctc
acaaagaacgatttagacaaggctaacaaagacaaggccaaccgctacttctcgccaaac
ttcaaggtgaagttgtattttacgaaaaccgtggaggagccttcaaactccgaggctagc
acttcgacgtccgtcaccccagacgttagcgacaatgagccagaccattatcgatactct
gacaccactgactctgatccggaaaatgaaccttttgatgaagagcaacacacgcaaatc
acaaaagtgtga

DBGET integrated database retrieval system