KEGG   Xiphophorus couchianus (Monterrey platyfish): 114138505
Entry
114138505         CDS       T05908                                 

Gene name
sufu
Definition
(RefSeq) suppressor of fused homolog isoform X1
  KO
K06229  suppressor of fused
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114138505 (sufu)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 114138505
NCBI-ProteinID: XP_027863616
LinkDB
Position
22
AA seq 471 aa
MDEIRPNSGAQAHGLVPLFPPGLQAIYGECRRLYPDQANPLQVTAIVKYWLGGPDPLDYI
SMYRNMGCAAQDVQEHWHYVSFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKREAGET
APPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLTEDPQMHPIQTP
FGAVSFLQIVGVCAEELQASQQWNGQGILELMRGIKVAGGPWLITDMRRGETIFEIDPHL
QQERVDQGIETEGSNLSGVSAKCVWDDLSRPPDDEEDSRSICIGSQPRRLSNKDTEQIRE
TLRKGLEFNSKAALPPISSQKQNHDRAQSRKDSLESESSAAIVPHELVRTRQLESVHLKF
NQESGTLLPLCLRGRLLHGRHFTYKSINGDTAITFVSTGVEGAFATEEHPYAAHGPWLQI
LLTEEFVEQMLGDLHELGSRDESKLPKEYSWPEKKLKISILPDSVFDNPLQ
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggatgaaatacggcctaacagtggtgcgcaagcccacgggctggtgccactgtttcct
cccggactgcaggctatatatggggaatgtcggcgactttaccccgatcaggccaacccg
ctgcaagttactgccattgttaaatattggcttggtggaccagaccccttagactacatc
agcatgtacaggaacatgggctgtgcggctcaggacgtccaggaacactggcactatgta
agctttggactcagtgacctgtatggagataatcgggtccacgaatttacaggaacagac
gggcccagcggatttgggtttgaacttaccttcaggctcaagagagaggcgggagagaca
gcacctccaacgtggcctgcagaactcatgcaaggattggctcgctatgtcttccagtca
gaaaacacattttgtagcggggatcatgtgtcatggcacagtccactggataacagcgag
tctcgcattcagcacatgttgcttactgaagacccgcagatgcaccccatccagactccg
tttggtgccgtcagctttctccagattgtgggcgtgtgtgcagaagagctgcaggcgtcc
cagcagtggaatggacagggcatcctggagctgatgcgtggaatcaaagtagctggcggc
ccctggctcatcactgacatgaggagaggagaaaccatttttgaaattgatccacatcta
caacaggagagagtggaccagggtattgaaaccgagggctctaacctgagcggcgtgagt
gccaagtgtgtgtgggatgacctgagccgacccccagacgacgaggaggacagccgatcc
atctgcatcggatcgcagcctcgccggctctcaaacaaagacacagaacagatcagagag
accctgagaaaaggactggagtttaacagcaaggcggccttgccacccatcagcagccag
aaacagaaccacgacagagctcaaagtcggaaggacagtttggagagtgaaagctcagca
gccatcgttcctcatgagttggtccgaactcgccagctggagagcgtccacctgaaattc
aaccaggagtccggcacgctgctgcccctctgtctgcggggcaggttactccacgggaga
cacttcacgtataaaagcatcaacggagacacggccatcacgtttgtctctactggagtc
gaaggagcttttgccactgaagagcatccctacgcggcgcatgggccctggcttcagata
ttgctgactgaagaatttgttgagcagatgctgggggatttacacgagctcggctctcgt
gatgagtcaaaattacccaaggaatacagctggccagagaagaagctgaagatttccatc
ctgccagactctgtgtttgataacccattgcaatga

DBGET integrated database retrieval system