KEGG   Xiphophorus couchianus (Monterrey platyfish): 114138665
Entry
114138665         CDS       T05908                                 

Gene name
egf
Definition
(RefSeq) pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04020  Calcium signaling pathway
xco04068  FoxO signaling pathway
xco04510  Focal adhesion
xco04540  Gap junction
xco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114138665 (egf)
   04012 ErbB signaling pathway
    114138665 (egf)
   04068 FoxO signaling pathway
    114138665 (egf)
   04020 Calcium signaling pathway
    114138665 (egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114138665 (egf)
   04540 Gap junction
    114138665 (egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114138665 (egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xco04052]
    114138665 (egf)
Cytokines and growth factors [BR:xco04052]
 Growth factors
  Growth factors (RTK binding)
   114138665 (egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA DUF5050 EGF_3 EGF
Other DBs
NCBI-GeneID: 114138665
NCBI-ProteinID: XP_027863852
LinkDB
Position
23
AA seq 1045 aa
MSLGGKNHRRLAAGTGSSILLDFHFREERLYWADRRTGIIYKASVQGAHRQKLYSSDKHI
SGLTVDWIGNGIFWTSSRKGEIKKMDLNGKNERTILRHLSQPSFINVDPTHRFLFWLSGG
SEIQRSDLSGQMKMTVLKLEEQLEALSVDRGDKRLFWVQLGLQGERAVASCDYSGNSLHI
MDLPLQSQSLGISVFLENVYYADAAAGIIRKINKYTGGRPVDVNDKPMVKPPVDIKVVHP
IIQPMADTSSLFPGCNDQSGSCVNVCSRLEEQGVCQCSEGFALSNHGTHCEDVNECAHWN
HGCSLGCENIPGSYFCTCPRGYTLLPDRKTCREITPCGGIIKCGHGCIATEDGAMCVCPE
GSVLQEDGHTCTGCSSADRGGCSQLCSSITPSRWQCGCLPGYRLHQDGKRCIATGPPAYL
IVANLMDVRRMNPDGTEEQTLVKEPRGTILALDFDPVHHRVYFASTSQRTIERIDLNTGS
RDVLVSDGLDSPEGLAIDWVHHTMYWSDRRKSAVDCSTLDGLKRKTVVKEGLEKPRGIAV
HPQAKKLFWTDTGAQPVVESATLEGSSRVIIASTGLMSPTGLTIDFTDDRLFWCDQMRGL
IETAALDGSNRRVLIENQVGRPFDLAVFEDRLWISEWEHQQIRSVHKRTGQKLQRIRGNL
VQPASVVVVHPLAKPGANACLHLNGGCAQKCESNQGLSHCSCLPHFTLSADGKSCLSVSS
SNVTAESGDETSNLTSLRNKTLHEESIIPLVGDNRKAGFISDGGTEPALFTEKMIADQND
CYSLHCAVSARCVLEAGNPLCLCQEGFTGDGQTCLALESTSPKVTSQTPMDVTTQHHNSN
AAEKCPPSHDAYCLYHGVCVYFPELKIYACNCIRGYLGERCQFSDLEWLELQQAEKEKER
NLVIGGCMVALIFIISITACITYCFRSRRLVLKQTSEDNVSEISVTDESMSETTTTSVPR
FYMVTENGVIHPDPRRAACSPCATETAIKPMSEHPASIFKHDKEYGNLKLPDATTETAQP
AAHRLSPSPSNSNTDNSSSVKPETQ
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgagcctgggtgggaagaaccacagacggcttgctgctggaacaggaagctccatcctt
ctcgactttcatttcagagaagagaggctttactgggccgacaggcgcaccggcatcatc
tacaaagcatcggtgcaaggagcacacagacagaaactgtattcatctgacaaacacatc
tccgggctcacagtggactggattggcaacgggatattctggacgagcagcagaaagggt
gaaatcaagaaaatggacttaaatggaaaaaatgagaggacaattttaagacatttgtct
caaccaagctttataaatgttgatcccactcacaggtttttgttttggctgtctggtgga
tcagaaatccagcgatctgatctctcaggtcaaatgaaaatgactgttttaaagctggag
gagcaacttgaggctctgtcagttgatcgaggagacaaacggttgttctgggttcagctt
ggtctccaaggagagcgagccgttgcttcctgtgattacagtgggaattcactgcacatc
atggacctgccacttcagtctcagtcacttggaatatctgtttttctggagaacgtttat
tacgctgatgctgcagccggcattataagaaaaataaacaaatacactggaggacgaccg
gtggatgttaatgataaaccgatggtcaaacctccggtggacataaaggtggtccatcca
atcatccagccaatggcagatacttcctcactatttccaggctgcaatgaccaaagtgga
agctgtgtgaatgtgtgttcccgtttagaggagcaaggggtttgccagtgctctgaaggc
tttgctctcagtaaccatgggactcactgtgaagatgtgaatgaatgtgcccactggaac
cacggctgctctcttggctgtgaaaacatcccaggttcatatttctgcacctgccccaga
ggatacaccctcctgccagaccggaagacatgtcgagaaataacaccatgtggcggcatc
ataaagtgtggacatggttgcatagcaacagaagatggggccatgtgtgtttgtcctgag
ggatctgttctacaggaggatggacacacttgcaccggttgctcttcagcagacagaggt
ggctgcagtcagctctgttcctccatcaccccgagtcgctggcagtgcggatgtcttcct
gggtacaggctccaccaagatggcaaacgctgcattgcaactggacctcctgcctatcta
attgtggccaatctgatggatgtgagaagaatgaacccagatgggacggaggaacaaact
ctagtgaaggaacccagaggaacaatcttagctctggactttgaccccgtccatcaccgt
gtctacttcgccagcaccagccagaggacaatagagcggattgatctgaacactggctca
agagacgttcttgtctctgatggtttggactctccagaaggactggcaatcgactgggtt
caccacactatgtactggtctgatagaagaaagtcagctgttgactgcagtacactagat
ggactgaagaggaaaactgttgtgaaagaaggcctggaaaagccaagaggaattgccgtt
catccccaagcgaagaagttattctggacagacaccggcgctcagcctgtggtagaaagc
gccactctggagggaagcagtcgtgtgatcattgccagcaccggcctcatgtctcccact
ggtctgaccatcgacttcactgatgatcgactcttctggtgcgaccagatgaggggcctg
atagaaacagcagctttggatggttctaatcgacgggtcctaatagagaaccaagtagga
cgtccctttgacctcgcagtatttgaggacaggctgtggatatctgagtgggagcaccaa
cagataaggagcgtccacaagcgcacagggcagaagctgcagcgtatccgtggcaacttg
gttcagccagcatcagtggtggtggtgcatcccctcgctaagccaggagcaaatgcttgt
cttcacctgaatggaggttgtgctcagaagtgtgaaagcaaccaaggactttcacattgc
tcctgtttgcctcacttcaccctgtcagctgatggaaaaagctgtttgtctgtcagttct
tcaaatgttactgcagaatctggcgatgaaacctccaacttaacatctctgagaaacaaa
acattacatgaggagagcatcatcccactggtgggtgataataggaaggctggtttcatc
tcagatggagggactgaaccagctctgttcacagaaaagatgattgcagaccagaatgac
tgttactcgctccactgtgctgtgagtgccaggtgtgtgctggaggctgggaaccctctc
tgtttgtgtcaggaaggctttacaggtgatggacagacatgtctggcactggagagcact
tctccgaaggtaacatctcaaacccccatggatgtgaccacccagcaccacaacagcaac
gcagcagagaagtgcccccccagccatgatgcctactgtctgtaccacggagtctgtgtc
tactttcctgagctaaagatctatgcctgcaactgtatccgaggctacttaggggaaaga
tgtcagttcagtgacctggaatggctggagctccaacaggctgagaaggagaaggagaga
aatctggtcattggaggttgcatggtggcgctcattttcatcatttccatcacagcctgt
atcacctactgtttccgatctaggagactcgtcctcaaacagacctcagaggataatgtg
agtgagatcagcgtgactgatgagagcatgtctgagacgacgaccaccagcgttcctcgt
ttctacatggtaacagaaaatggtgtcatccatccagatccaaggagagctgcctgctca
ccatgtgctacagaaacagccatcaaacctatgtctgaacatccggcatcaatcttcaaa
catgacaaagaatatgggaatttaaagcttccagatgccaccacagagaccgcccagcct
gctgcccatcgcttgagtccttcaccatcaaactcaaacacagacaattcttcatctgtc
aaaccagaaacacaataa

DBGET integrated database retrieval system