KEGG   Xiphophorus couchianus (Monterrey platyfish): 114138794
Entry
114138794         CDS       T05908                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11 isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04114  Oocyte meiosis
xco04120  Ubiquitin mediated proteolysis
xco04218  Cellular senescence
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114138794
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114138794
   04340 Hedgehog signaling pathway
    114138794
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    114138794
   04218 Cellular senescence
    114138794
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xco04121]
    114138794
   03036 Chromosome and associated proteins [BR:xco03036]
    114138794
Ubiquitin system [BR:xco04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     114138794
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     114138794
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160 WD40_2
Other DBs
NCBI-GeneID: 114138794
NCBI-ProteinID: XP_027864016
LinkDB
Position
23
AA seq 562 aa
MEPEMEDKTVELMCSVPRSLWLGCSSVAESLCALRCLQSIPSTRAHNQTTSGMESQTLVD
DLSPKKTTMVKLTNGPVIGSRKRPSEGNYEKEKEHCIALFDQWSEADQVEFVERLISRMC
HYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCAAELVCKEWQRVISE
GMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRTSEIPPNSYYHSLYPKIIQDIETIE
ANWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKVLTGHT
GSVLCLQYDERVIVTGSSDSTVRVWEVTTGEVLNTLIHHNEAVLHLRFANGLMVTCSKDR
SIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLN
GHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGA
YDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFL
NVSPNGQSEGRSPSRTYTYISR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggagccggagatggaagacaaaacggtggaactgatgtgctctgtgcctcgctctctc
tggctgggctgctcctcggtggctgagagtttgtgtgcactcaggtgcctgcagagcatc
ccctccacccgggctcacaaccagaccacgtcagggatggagtcacagaccttagtggac
gacctgtcgccaaagaagactacaatggtgaagcttactaacggtcctgtaatagggtct
cgtaagcgtccatcagaagggaactatgagaaggagaaggaacactgcatcgccttgttt
gaccagtggtcagaggccgaccaagtggagtttgtcgagcggctgatatcccgtatgtgc
cactaccagcacggccacatcaactcctacctcaaacccatgctgcagagggatttcatc
actgcattgccagcccaaggattggatcacattgcagagaacatcctgtcttttctggat
gcacgttcgctttgcgctgcagagctggtatgtaaagagtggcagagggtaatctctgag
ggtatgctgtggaagaagctcattgagcgaatggtccggaccgacccgctttggaaaggc
ctgtctgaaagacaccagtgggagaaatatttgttcaagaaccgcacatcagaaatcccg
cccaactcctactatcactctctttatcctaagatcattcaagacatagagacaattgag
gctaattggcgatgtggcagacacaacttgcaaaggattcagtgtcgttcagaaaacagt
aaaggtgtttattgtctccagtacgatgatgagaagatcatcagtggccttagggacaac
tccatcaagatctgggataaacaaacactggaatgtctgaaggtactgaccggccacaca
ggctcagtattgtgtctccagtatgatgagagagtcatcgtcactgggtcttctgactcg
actgtcagggtttgggaagtcacgacgggtgaggtactcaacacgttgatccatcacaac
gaggctgttcttcacctgcgattcgcaaatggtctcatggtcacctgctccaaggaccgc
tcgattgcagtgtgggacatggcctcgcctactgacatcagcctgcggcgcgtccttgtt
ggacatcgtgctgctgtcaatgtcgttgacttcgatgataaatatattgtgtctgcctca
ggggaccgcaccatcaaggtgtggagcaccagcacctgtgagtttgtgcgcactctaaat
ggtcacaagcgggggattgcctgtttacagtatagagatcgtctggtagtcagcggctca
tctgacaacacaatccggttatgggacatcgagtgcggggcatgtttgcgagtgctggaa
ggtcacgaggagttggtgcgctgcattcgcttcgacaacaaaaggatcgtcagcggagcc
tacgatggcaaaataaaagtgtgggacctgcaggcagcacttgacccacgagcccctgct
agcacattatgtctgcggactctagtggagcactctggccgtgttttccgcctgcagttt
gatgagtttcagatcatcagcagttctcacgacgacaccattctgatctgggatttcctg
aacgtctcacctaatggccagtcagagggacgatctccgtcccgtacctacacgtacatt
tctagatag

DBGET integrated database retrieval system