KEGG   Xiphophorus couchianus (Monterrey platyfish): 114139116
Entry
114139116         CDS       T05908                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114139116
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xco03000]
    114139116
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:xco03310]
    114139116
Transcription factors [BR:xco03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    114139116
Nuclear receptors [BR:xco03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   114139116
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 114139116
NCBI-ProteinID: XP_027864590
LinkDB
Position
23
AA seq 767 aa
MDQGGVKKIAYRRNDHLSKLVYTESPEEGGLLKVAPHSAMSITSPPSVVLPSSPLMQPGQ
VTNGLSNSPLPEELASAPATIGSSVDSSETRGLTKDQRPEELQLFQTQTFNTFGHQVLPQ
LDASMADITQSSMDSLIGGSDPNLFAVKTEDFSMDKSEQDPNDLDHAFDHIGKDVDMNQK
LFNETSLDLLQEFDLTASPSDFYVGDDDAFLSTLADDSLLADGEMRGTTERDVKPSVVES
VGTTRVCDSSKASSPLESKSKTPSLTPTTTFPAVVKKEKDTGFIQLCTPGVIKKEKTSSG
YCQMSGSSPISICGVSTSGGQSFHFGINARNNDALQEKDQKPVSGLFLPVTTISGAWNRN
QGDNSAIRRASEIFSSSPSFSSSFASSISRQEGGTPTSTTQGKSGTHKICLVCSDEASGC
HYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLEAR
KTKKLNRLKGNQNSNPPEMMPSPPVEARSLVPKCMPQLVPTMLSLLKAIEPDTIYAGYDG
TLPDTSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQCSWLFLMSFGLGW
RSYQQCNGNMLCFAPDLVINEERMKLPYMAEQFEQMLKISSEFVRLQVSHDEYLCMKVLL
LLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMHEMGS
GLLSFCFYTFVNKFLSVEFPEMLAEIISNQLPKFKAGSVKPLLFHQK
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggatcaaggtggagtgaagaagatagcgtacagaagaaatgaccatctaagcaaactg
gtctacactgaaagccctgaggagggaggtcttctaaaggtggctcctcacagtgccatg
tccatcacctctcctccttctgttgttcttccatccagcccattaatgcagcctggacag
gtgaccaacggcctcagcaacagcccacttccagaggagcttgcttcagcccctgccacg
atcggttcctcggttgacagttcagaaaccaggggcctgaccaaagatcagaggcctgaa
gagctacagttgttccaaacgcagactttcaatacttttgggcatcaggtcctgccccag
ttggatgccagcatggcagacattacccagtcctccatggactccctcatcggggggtcg
gatcccaacctatttgctgtgaaaacggaggatttctccatggataaaagcgagcaggac
cccaacgatctggaccatgcctttgaccacattggcaaagatgtggacatgaaccagaaa
ctgttcaacgaaaccagtctggatctccttcaagagtttgacctcaccgcatccccctcc
gatttttacgttggggacgatgatgcctttttgtccacgctggcagacgattctttgctc
gcagacggggaaatgagagggacgactgagagggacgtgaaaccctccgtggttgagagc
gtcggcaccaccagagtctgcgacagcagcaaggcatcaagcccacttgaatccaagtcc
aagactccttctttgacccctacaaccacttttcccgccgtggtgaagaaagaaaaagat
accggcttcattcagctctgcacaccaggcgtgattaagaaggagaagacgtcttcgggg
tattgtcagatgagcggctcaagccccatctctatctgcggggtgagcacttcagggggc
cagagcttccactttggaatcaacgccagaaacaacgacgctctgcaggagaaggaccag
aaacccgtgtctggcttgttcctcccagtaacgaccatcagtggagcctggaaccggaac
cagggcgacaactcagcaatccgcagggccagtgagattttctcaagctctccttccttc
tcctccagctttgccagttccatctccagacaggaagggggcactccaacatccacgacc
cagggaaagagcgggactcataaaatctgtctggtgtgctctgatgaggcctcggggtgc
cattatggagtcctcacatgtggcagctgcaaggtcttcttcaagagagcagtggaaggc
cagcataattacctgtgtgctgggaggaacgactgcatcattgacaaaatcaggcgaaag
aactgcccggcctgccgcttccgcaaatgcctgatggcaggcatgaacctggaagctcgc
aaaacaaagaagttgaatcgcttaaagggcaaccagaacagcaacccgccagagatgatg
ccttcgccgccggtcgaggctcgctcgctggtgcccaagtgcatgcctcaactcgtcccc
accatgctgtccctgctgaaggccatagagccggacaccatctacgccggctacgatggc
acgctccccgacacgtccacgcgcctcatgaccacgctgaacaggctgggtgggcgacag
gtcatctctgccgtgaagtgggccaaagctctgccaggtttcaggaacctgcacctggat
gatcagatgaccctgctgcagtgctcctggctcttcctcatgtctttcggcctgggctgg
aggtcttaccagcagtgcaacggcaacatgctctgcttcgcaccagacctcgtcatcaat
gaggagcggatgaagctgccctacatggccgagcagtttgagcagatgctgaagatttcc
agcgagttcgtccggctgcaggtttcccatgatgagtacctgtgcatgaaggtcctgctg
ctgctcagcacagtgcccaaggacggcctgaagagccaggcggtgttcgacgagatccgc
atgtcgtacatcaaagagctgggaaaagccatagtgaagcgcgaggagaactccagccag
aactggcagcgtttctaccagctcaccaagttgttggactccatgcatgagatgggcagc
ggactgctcagcttctgcttctacacctttgtgaataaattcctgagcgtggagttcccc
gagatgctggccgagatcatcagcaatcagctaccaaaattcaaggctggaagcgtcaaa
cctctcctcttccaccagaagtga

DBGET integrated database retrieval system