KEGG   Xiphophorus couchianus (Monterrey platyfish): 114139185
Entry
114139185         CDS       T05908                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114139185
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114139185
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xco04052]
    114139185
   00536 Glycosaminoglycan binding proteins [BR:xco00536]
    114139185
Cytokines and growth factors [BR:xco04052]
 Growth factors
  Growth factors (RTK binding)
   114139185
Glycosaminoglycan binding proteins [BR:xco00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   114139185
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 114139185
NCBI-ProteinID: XP_027864739
LinkDB
Position
23
AA seq 158 aa
MMADEDAFADEERAFDGGPTLRDYRRSTRLYCMNGGYHLQILADGTVRGERDERDDHTVL
KLKAVGRGVVVIRGTAAERYLAMSAEGRLYGSSTVTEECYFVENLEENYYNTYKSQKYQD
SSWYVGLKKNGRTKLGPRTHIGQKAIFFIPRQLEDSWD
NT seq 477 nt   +upstreamnt  +downstreamnt
atgatggcggatgaagacgcgttcgcggacgaagagcgagcttttgacggcggccccacg
ctgcgcgactaccggcggtcgacgcggctgtactgcatgaacggcggataccacctccag
atcctggccgatgggacggtgcggggcgagcgggatgagcgggatgatcacactgtgctg
aagctcaaagccgtgggcagaggcgtcgttgtcatccggggaacggcggcagagcgatat
ctggccatgagcgccgaaggccgtctgtacggctcatccacagtaacagaggagtgctac
tttgtggagaacctggaggagaactactacaacacgtacaagtctcagaaataccaggac
agcagctggtacgtcggcctgaagaagaacggcagaactaaactaggtccaagaacccac
atcggacagaaggccatcttcttcatccccagacagctggaggattcctgggattag

DBGET integrated database retrieval system