KEGG   Xiphophorus couchianus (Monterrey platyfish): 114139220
Entry
114139220         CDS       T05908                                 

Gene name
kif3a
Definition
(RefSeq) kinesin-like protein KIF3A isoform X1
  KO
K10394  kinesin family member 3A
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114139220 (kif3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xco04812]
    114139220 (kif3a)
Cytoskeleton proteins [BR:xco04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     114139220 (kif3a)
SSDB
Motif
Pfam: Kinesin Microtub_bd PIF1
Other DBs
NCBI-GeneID: 114139220
NCBI-ProteinID: XP_027864804
LinkDB
Position
23
AA seq 701 aa
MPSSKAEKQEVSDNVKVVVRCRPLNQKEKMMAHKQAVIVDEIRGTITVNKLEIPHEPPKT
FTFDTVFGPDSKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELR
GIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQLQRLEVKERPDVGVY
IKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNQH
VRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNS
KLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALL
RQFQKEIEELKKKLEEGEEISGSDGSGSEEMDEGDDEAGEAGEGRRRRRGRKKVSPDKMV
EMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLLKAQQEHHLLLEKLSALEKKVI
VGGVDLLAKAEEQERLLDESNNELEERRKRAEQLRKELEEKEQERLDIEEKYTSLQEEAQ
GKTKKLKKVWTMLMAAKSEMADLQQEHNREIEGLLENIRQLSRELRLQMLIIDNFIPQEY
QAMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESM
RQSLMKLERPKASKGSKSGRPKTGRRKRSAKPDTVIDSLLQ
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgccgagcagtaaggctgagaaacaggaagtcagtgataatgtcaaagttgtggtaaga
tgtcgtcccctcaaccagaaggagaagatgatggcccacaagcaggccgtcattgtggac
gagatccgtggcaccataacggtgaacaaactggagatcccccacgaacctcctaagaca
ttcacctttgacactgtgtttgggcctgacagcaagcagctagatgtctacaacctcaca
gcccgcccaatcatcgactccgttttagagggatataacggcacaatttttgcatatggg
caaactggcacaggaaaaaccttcaccatggagggggtaagggcggtaccagaacttcga
gggattattccaaattcttttgctcatgtttttggacacattgccaaggcagagggcgac
acaaggtttttagttcgtgtttcatacctggagatttacaacgaggaagtgcgggatttg
ctgggcaaggaccagttgcaaaggcttgaggtcaaagaaagacccgatgttggcgtgtac
atcaaagatctctctggttatgttgtaaataatgctgacgatatggacagaattatgaca
ctcggtcacaaaaaccgatccgtcggtgctacaaacatgaatgagcacagctcccgctct
catgccatcttcaccatcaccatcgagtgcagtgagaagggtgtggatggtaaccagcat
gtgcgcatgggaaagcttcatctcgtagatctggcaggttcagaaagacagggcaaaact
ggagccacaggtcagcgtttgaaggaagcaacgaagatcaatctgtccctctccaccctg
ggtaacgttatctccgccctggtggacggcaagagcactcacgtcccctacagaaactcc
aaactgacccgtttgcttcaggattcgctggggggaaactccaagaccatgatgtgtgca
aatataggtcctgcagactacaattatgacgagaccatcagtaccttgcgctatgctaac
agggctaaaaacatcaaaaacaaagccagaatcaacgaagatcccaaggacgcccttcta
cggcagtttcagaaagagatcgaggagctcaaaaagaaactggaagagggtgaagagatt
tctggctcagacggcagtggatcagaggagatggatgaaggggacgatgaggcaggagaa
gcaggagaaggccgacggaggaggaggggaaggaagaaggtttctccagacaagatggtg
gagatgcaggcaaagattgaggaggaaagaaaggccctggaggccaagctggacatggag
gaggaggagaggaacaaggcaagagcagagctggagaaaagggagaaggatcttcttaaa
gcccaacaggagcatcacctcctgctagagaaattgtcggctttagagaagaaggtgatt
gtaggtggagtggatcttctcgctaaggctgaggagcaggagaggctcctggatgaatcg
aataatgagcttgaggagcgtcgcaagcgagcagaacagctacgcaaggagctggaagag
aaagagcaagaacgtttagatatagaagagaagtacacaagtctgcaggaggaagctcaa
ggaaagaccaaaaagctgaagaaagtgtggaccatgctaatggctgccaaatcagaaatg
gcagatctgcaacaagagcacaacagagagattgagggcctcctggaaaacatccgccag
ctgagtcgagaactgaggctccagatgctcatcatagataactttattccccaggagtat
caggcgatgatagaaaattatgtccactggaatgaagatattggagaatggcagctgaaa
tgtgtggcttacactggcaataatatgagaaaacaaaccccagttccagacaaaaaagaa
aaagatccatttgaggtggatctgtcccacgtgtacctagcatatacagaggagagcatg
cggcaatcactgatgaaactagagaggcccaaagcctctaaaggcagtaaaagtggcaga
ccgaagaccggccgaaggaaaagatccgcaaaaccagacacagtgatcgattcccttctg
cagtga

DBGET integrated database retrieval system