KEGG   Xiphophorus couchianus (Monterrey platyfish): 114140033Help
Entry
114140033         CDS       T05908                                 

Gene name
bcl3
Definition
(RefSeq) B-cell lymphoma 3 protein
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_3 Ank Ank_4 Ank_5 DUF3447
Motif
Other DBs
NCBI-GeneID: 114140033
NCBI-ProteinID: XP_027865688
LinkDB All DBs
Position
3
AA seq 494 aa AA seqDB search
MPSLITMSVDHQSVAAAPLDLSTTARGRRNAGDLTFCAGDARATGGSPAPPASTGTDSSA
ARRSPDAESTQLGKRAADSSPIKTPSKLPFRKRTFPVEQEVQKPAAPISVASSPCSSPAE
EQKVRKSAASRLERAADESRFAVAPVTHRRTEQAAHSPEGYSCCILPIINYGHYPVCLPP
FPEPHHPRVHQTDNLLTGISLATHQDEDGDTALHIAVVQGELPIVHKLIHLLVLARRGLD
IYNNLRQTPLHLAVITKQANMVDVLLRAGADPAVLDRHGQTALHLCCEYQLLECLSVLLS
FSSSSPCLEIRNFEGLSPLHLAVLQGHKNLAKMLLDAGADINVMDIKSGQSPLMHAVESN
NADMVHFLIENGCDVNSQSYSRNTALHIACGRGQVDTVRLLLKSGADSSLKNYHNDTPVM
VAKNKKITDVLRGRGSKQIKVQEQPCVSVSPRQSCYMENGSPSSNHSHGSTPPTTPHSFL
PSASHPLKTSSALF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtcttattacaatgagcgttgaccaccagtcggttgccgcagcgccgctggat
ctgagcaccacagctcgagggcgcaggaacgcgggggacttaaccttttgcgccggggac
gcccgggcgaccggcggctcacctgcgcctcctgcgagcaccgggacggacagttcagcg
gctcgccgctccccggacgcggaaagcactcagctcggcaaacgagcagcggactcatct
cccataaagactccatcgaagcttccttttaggaagcgcacgtttcccgtcgaacaggag
gtccagaagccggctgcaccgatttcagtggcaagctcaccctgctcttcccccgcagag
gagcagaaagtccggaagagtgcggctagtcgcttggagagagcagcggatgaaagcagg
ttcgccgttgcaccggtgacccacaggcggaccgagcaagcagctcacagtccggaaggc
tattcctgctgcatcttgcccattattaattacggtcactacccagtgtgcctgcccccc
tttccagagccacaccacccacgagtacaccagactgacaacctgctgacaggaatttct
ctggccacacatcaggatgaagacggagacacagccctccatatagctgtggttcaagga
gaattgcccatcgtccacaaactcatccacctgttggtgttggctcgaagaggccttgat
atctacaacaatcttcgtcagactcctcttcatctggcagtgataaccaagcaagcaaac
atggtggatgttttgttgagggcgggggccgaccctgctgtcttggaccgtcatggccaa
acagcactccatctctgctgtgaatatcagctgctcgaatgcctatctgtactgctgtct
ttctcctcatcttcaccctgcctggagatcagaaactttgaaggtctgagtcctcttcat
ttggctgtgctgcaaggccataaaaatttggcaaaaatgctgctggatgcaggagcagac
atcaacgtgatggacattaagagtggtcagagtcctctcatgcatgccgtggaaagcaat
aatgcagatatggtccacttcctcattgagaatggctgtgacgtcaacagccagtcgtac
agcaggaacacagctctgcacatcgcctgtggccgaggtcaggtggataccgtccggctg
ctgctgaagagcggagcagacagtagtctcaagaactaccacaatgatacgccagtgatg
gtggccaagaataaaaaaataacagatgtgttacgaggaagaggatccaagcagatcaaa
gttcaagagcagccttgtgtgtcggtctcaccgcgtcagagttgctatatggagaatgga
tccccttcttcaaaccacagtcatggatctacacctcctacaacaccacacagcttcctt
cctagtgcttcccatcccctaaagacttcgtctgcactattctag

DBGET integrated database retrieval system