KEGG   Xiphophorus couchianus (Monterrey platyfish): 114140444
Entry
114140444         CDS       T05908                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04210  Apoptosis
xco04620  Toll-like receptor signaling pathway
xco04621  NOD-like receptor signaling pathway
xco04622  RIG-I-like receptor signaling pathway
xco04623  Cytosolic DNA-sensing pathway
xco04625  C-type lectin receptor signaling pathway
xco04920  Adipocytokine signaling pathway
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114140444 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114140444 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114140444 (ikbkg)
   04621 NOD-like receptor signaling pathway
    114140444 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    114140444 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    114140444 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    114140444 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114140444 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114140444 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114140444 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114140444 (ikbkg)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   114140444 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 Metal_resist
Other DBs
NCBI-GeneID: 114140444
NCBI-ProteinID: XP_027866141
LinkDB
Position
1
AA seq 583 aa
MVQPQPDGPMQWDMSGEDSGGTLRVPPELAGNEVVTRLLGDNQQLREALRRSNQALRQRC
EEMEGWQRRTREEREFLSCRFQEARALVERLAQENHSLQSMVNGPGSSSNRSYSSAQMEA
SPGLPARNGPLDEPKTLDQWERKRVEETEQQTQTTPLRSLPAEGANEFLQLLKSHKEKTE
EEMREMRRKNEELKRERDEGKEVLERQHRCIEHLRAKLFHTQMSSNEEAVQLRSEAQHTS
DCSSLAKLTEQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKDKDCAQLAKDCEAL
KAQATSLLGELNERQILLQKSDDERKMLEEKLVSKVKALQAAERELEQQRKQHHVANDKL
LLQVQSLENALKSERHVVTEEKKKLSQLQHAYTCLFRDYDSKLKSEGGDLSSKLEEAERA
LAIKQDLIDKLKEEVEQQKGSLETVPVLTAQAEIYKADFLAEREAREKLNQKKEELQEQF
TQALAEIERLKHELTARARLEQMKLKHMDDFPARQTHIPPQQVVGFPGAGFNTVPPNRNH
VLAPVIDPAAAGAADLPDLCCPKCNYLAPDMDTLQIHVMDCIQ
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggtgcagccacagccggacggccccatgcagtgggacatgtctggggaggacagcgga
gggacactcagggtcccaccagagctcgctggcaatgaagtggtgaccagactgttgggc
gacaaccagcagctccgagaggctctgcggaggagcaaccaggccctgcgtcagcgctgc
gaagagatggagggatggcagcggcggaccagggaggaacgggaattcctcagctgtcgt
ttccaggaggcccgggcgctggtggagaggctggcgcaggagaaccactctttgcagagc
atggtgaacggaccaggctcgtcgtccaaccgcagctacagctcggcccaaatggaggcg
tcaccggggcttcctgcccggaacggccctctggatgaaccaaagactttagaccaatgg
gagaggaaaagagttgaagaaacggagcagcagacacaaaccacaccactccgcagcctg
cctgcagagggtgcaaatgagttcctgcaactgctgaagagccacaaagaaaaaacagag
gaagagatgagagagatgagaaggaaaaatgaagagttaaagagggaacgggacgaggga
aaagaagtgttagagcgacagcatcgatgcattgaacacctgcgagctaaactgttccat
acacagatgagcagtaatgaggaagctgttcagcttcgctcagaggctcagcacacctct
gactgctctagtctggctaaactcacagagcagcttcaggccacacagggcaggtatcgg
gagctggaggagaaactagattacctgcagaagagctccgctcagcgggacagaacagaa
gctttgctcaaacaaaaggacaaggattgtgcccagttggccaaggactgtgaggctctg
aaagctcaggcgacgtcgctgttaggcgaactgaatgagaggcagatcctcctgcagaag
agcgacgatgagcgcaaaatgttggaggagaagctggtcagcaaggtgaaggccctgcag
gcggcggagcgggagctggagcagcagaggaagcagcatcatgtggccaatgacaagctg
ctgctgcaggtgcagagcctggagaacgcgctgaagtcggagaggcacgtggtgacagag
gagaagaaaaagctgtcacagttgcagcacgcctacacgtgtctgttcagagactatgat
tccaaactgaagagtgagggaggagaccttagcagtaagctagaggaggcagagcgggca
ctggccatcaagcaggacctgattgataaactcaaggaggaggtggagcagcagaaaggc
tcgctggaaaccgtccctgtcctcacagcacaggctgagatctacaaggcagatttcctg
gcagagcgagaagcgagagagaagctgaaccagaagaaagaggagctgcaggaacagttc
actcaggctctggctgagattgaacggttgaagcacgagctcacagcacgtgcacgtttg
gaacaaatgaagctgaaacacatggatgattttcctgcacggcaaactcacattccccct
cagcaagttgttgggtttcctggtgctggcttcaacaccgtgccaccgaaccggaaccac
gttttggcaccggtcatcgatcctgctgcagcaggagctgcagatctgcctgatttatgc
tgtccaaagtgcaactacctggctccagatatggacacactgcagatacacgtcatggac
tgtatacagtaa

DBGET integrated database retrieval system