KEGG   Xiphophorus couchianus (Monterrey platyfish): 114141391
Entry
114141391         CDS       T05908                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114141391
   04370 VEGF signaling pathway
    114141391
   04068 FoxO signaling pathway
    114141391
   04070 Phosphatidylinositol signaling system
    114141391
   04150 mTOR signaling pathway
    114141391
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114141391
  09143 Cell growth and death
   04210 Apoptosis
    114141391
   04218 Cellular senescence
    114141391
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114141391
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114141391
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114141391
   04625 C-type lectin receptor signaling pathway
    114141391
  09152 Endocrine system
   04910 Insulin signaling pathway
    114141391
   04914 Progesterone-mediated oocyte maturation
    114141391
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114141391
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114141391
Membrane trafficking [BR:xco04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114141391
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 GLTSCR1 Exonuc_VII_L
Other DBs
NCBI-GeneID: 114141391
NCBI-ProteinID: XP_027867725
LinkDB
Position
Unknown
AA seq 473 aa
MAAGSFWTRTLRELSGEDRNLQPCVPPAAPLPLGGSAAGLEQQQGALQPPALPPKPIKLQ
ASSSSGVRGDDGDSLQEAEWYWGDISREEVNEKLRDTPDGTFLVRDASTKMQGDYTLTLR
KGGNNKLIKIYHRDGKFGFSEPLTFSSVVELIGHYRHQSLAQYNTKLDVRLTYPVSRFQQ
DQLVKEDNIDAVGKKLLEYHSQYQEKSKEYDRMYEEFTKTSQEIQMKRTAIEAFNETIKI
FEEQCQTQERCSQDCVERCSRCSGDKDMERILVNFEKLKSRLGEIHDSKVRLEQDLKTQA
TENRETDKKMNSLKPDLIQLRKIRDQHLVWLNHKGVRQKRINDWLGIQNDAAAEGGEEEE
SLPHYDEKSWFVGDVSRTQAEELLGGKPDGAFLIRESSKKGCYACSVVASGAVKHCVIYS
TPRGFGFAEPYFLYGSLKELVLHYRLTSLVQHNDALNVRLAHPVHAPAPPLCR
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggctgctgggagtttctggacccggacgctccgtgaactcagcggggaggaccggaac
ctgcagccctgcgtcccgccggcggcccccttgccgctgggtggctctgcagccggactg
gagcagcagcagggggccctgcagcctccagctcttcctccaaagccaatcaaactccag
gcgtcgtcttcttccggggtcagaggtgacgatggcgactcgctgcaggaagcagagtgg
tactggggagacatatccagggaggaggtgaacgagaagctgagggacacgccggacggg
accttcctggtgcgggacgcctccaccaagatgcagggggactacaccctgaccctgagg
aagggaggcaacaacaaactgattaagatctaccacagagacgggaagtttggcttctct
gagccgctgaccttcagctccgtggtggagctcatcggccattaccggcaccagtcactg
gcccagtacaacaccaagctggacgttcgcctcacctacccggtgtcccgcttccagcag
gaccagctggtgaaggaggacaacattgacgctgtggggaaaaagctgctggaatatcac
agccagtatcaggagaagagcaaagagtacgaccggatgtacgaggaattcaccaagacc
tcccaggagatccagatgaagcgcacggccatcgaggccttcaacgagaccatcaagatc
ttcgaggagcagtgccagacgcaggagcgctgcagccaggactgcgtggagcgctgcagc
cgctgcagcggcgacaaggacatggagcgcatcctggtcaacttcgagaagctcaagtcc
cgcctgggggagatccacgacagcaaggtgcgtttggagcaggacctgaagacgcaggcc
acggagaaccgtgagacggacaagaagatgaacagcctgaagcccgacctcatccagctg
cgcaagatccgcgaccagcacctggtctggctgaaccataaaggagtccggcagaaacga
atcaacgactggctcggcatacagaacgacgccgctgccgaaggcggcgaggaagaggag
agcctgcctcactacgacgagaagagctggttcgtaggagacgtgagccggacgcaggcg
gaggagctgctgggcgggaagccagacggagccttcctgatccgggagagcagcaagaag
ggctgctacgcctgctctgtggtggcgtcgggcgcggtgaagcactgcgtcatctacagc
acgccgcgtggcttcggcttcgccgagccgtacttcctgtacggcagcctgaaggagctg
gtcctccactaccgcctcacctcgctggtgcagcacaacgacgcgctcaacgtgcgcctc
gcccaccccgtccacgcccccgcgccccccctctgcaggtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114144576
Entry
114144576         CDS       T05908                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha-like isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114144576
   04370 VEGF signaling pathway
    114144576
   04068 FoxO signaling pathway
    114144576
   04070 Phosphatidylinositol signaling system
    114144576
   04150 mTOR signaling pathway
    114144576
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114144576
  09143 Cell growth and death
   04210 Apoptosis
    114144576
   04218 Cellular senescence
    114144576
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114144576
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114144576
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114144576
   04625 C-type lectin receptor signaling pathway
    114144576
  09152 Endocrine system
   04910 Insulin signaling pathway
    114144576
   04914 Progesterone-mediated oocyte maturation
    114144576
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114144576
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114144576
Membrane trafficking [BR:xco04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114144576
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 AAA_13 RNA_binding Bap31_Bap29_C
Other DBs
NCBI-GeneID: 114144576
NCBI-ProteinID: XP_027873361
LinkDB
Position
5
AA seq 717 aa
MSSEGFQYRALYDYKKERDEDIDLRVGDMLLVSRGALLALGCGSGDEERPSEIGWLPGFN
ETTQEKGDFPGTYVEFVGRKRMSPPTPKPRPPRPPSTASMRTDSESEGLVLPDLPDQFGP
PDTAPPLLSRLMELIETKGSDSPVLYRSMSGGVLDTRQLADTEPEQLDVPSLCDGVVRFL
QDLPGPVLPASLQADMSHAVQEVRDPEECAQVLRGVASSPACPAQFGLTLLSVVRHLARL
SLHGSRNQLSPRVLAENFSPLLFRQPAGSDSALDPLVQVLEVLITSELNMTQAAPALPPK
PVKASTAAPSSTFNNSISLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYT
LTLRKGGNNKLIKIFHREGKYGFSDPLTFSSVVELINHYRHESLAQYNPKLDVKLLYPVS
KHQQDQVVKEDSVEAVGKKLHEYHLQYQEKNREYDRLYEEYTRTSQEIQMKRTAIEAFNE
TIKIFEEQCQTQERFSKEYIEKFRREGNDKEIQRIMENYDKLKSRISEIVDSKRHLEVDL
KKQAADNREIDKKMNSIKPDLIQLRKTRDQYLMWLTQKGVRQRKLNEWLDLKNETTEDEY
STVEDEEDLPHHDERLWRLGNMNRLQAEGLLRGKRDGTFLVRDSSKPGCYACSVVVDGEV
KHCVINKTGTGFGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVTLAFPVFSPQRR
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgagctccgagggcttccagtaccgagcgctgtacgactacaagaaggagcgggatgag
gacatcgacctgcgcgtgggggacatgctgctggtcagcaggggggcgctgctggcgctg
ggctgcggcagcggagacgaggagcggccgtctgagatcggctggctgccgggcttcaac
gagaccacgcaggagaaaggcgacttcccaggaacgtacgtggagttcgtcggcaggaag
aggatgtccccgcccactccgaagccccgcccacccagaccgccgtccaccgcctccatg
aggaccgactcggagtcagagggtttggttctgccggacctgccggaccagttcggacct
ccagacacggcgccgccgctcctcagcagactgatggagctcatagagaccaaaggttct
gacagcccggttctgtaccgcagcatgagtggaggggttctggacacccggcagctggcc
gacaccgagccggagcagctggacgtgccgtcgctgtgtgacggggtggtccggttcctg
caggacctgcccggtccggtcctgcccgcctcgctgcaggccgacatgagccacgccgtc
caagaggtccgggacccagaggagtgcgcccaggttctgcggggcgtggcgagctcgccg
gcctgcccggcccagttcgggctgaccctgctcagcgtggtccggcacctggcccggctc
agtctgcacggctccaggaaccagctgagcccgcgggttctggccgagaacttcagcccg
cttttgttcaggcagcccgctgggtccgactccgctctggatcctctcgttcaggttctg
gaggttctgatcaccagcgaactcaacatgacccaagcagcaccagctctgcctcccaaa
ccggtgaaggcctccactgctgctccctccagcaccttcaacaacagcatctccctgcag
gacgccgagtggtactggggggacatttccagggaggaggtgaacgagaagctgagagac
acagccgacggcaccttcctggtgcgggacgcctccaccaagatgcacggagattacacc
ctgaccctcaggaagggaggcaacaacaagctgatcaagatcttccatcgggaggggaag
tacggcttctctgacccgctgaccttcagctcggtggtggagctcatcaaccactatcgc
cacgagtctctggcccagtacaaccccaagctggacgtcaagctgctctacccggtgtcc
aagcaccagcaggaccaggtggtgaaggaggacagcgtggaggccgtgggcaagaagctg
catgagtaccacctgcagtaccaggagaagaaccgcgagtacgaccggctgtacgaggag
tacaccagaacgtcgcaggagatccagatgaagcgcaccgccatcgaggccttcaacgag
accatcaagatcttcgaggagcagtgccagacgcaggagcgcttcagcaaggagtacatc
gagaagttccgccgcgagggcaacgacaaggagatccagaggatcatggagaactacgac
aagctgaagtctcggatcagcgaaatcgtggacagcaagcgccacctggaggtggacctg
aagaagcaggcggccgacaaccgggagatcgacaagaagatgaacagcatcaaaccggac
ctgatccagcttcgcaagacccgggaccagtacctgatgtggctgacccagaaaggagtc
cggcagaggaagctgaacgagtggctggacctgaagaacgagaccaccgaggatgagtac
agcacggtggaggatgaggaggaccttcctcaccacgacgagcggctgtggcgtctgggg
aacatgaaccggctgcaggccgagggcctgctgcgcggcaagcgggacggaaccttcctg
gtccgggacagcagcaagccgggctgctacgcctgctccgtggtggtggacggcgaggtc
aagcactgcgtcatcaacaagaccggcaccggcttcgggttcgccgagccgtacaacctg
tacgggtcgctgaaggagctggttctgcactaccagcacacatcgctggtccagcacaac
gactcgctcaacgtcacgctggccttccccgtcttcagcccgcagcgccggtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114144651
Entry
114144651         CDS       T05908                                 

Gene name
pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00562  Inositol phosphate metabolism
xco01100  Metabolic pathways
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114144651 (pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114144651 (pik3cd)
   04370 VEGF signaling pathway
    114144651 (pik3cd)
   04068 FoxO signaling pathway
    114144651 (pik3cd)
   04070 Phosphatidylinositol signaling system
    114144651 (pik3cd)
   04150 mTOR signaling pathway
    114144651 (pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114144651 (pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    114144651 (pik3cd)
   04218 Cellular senescence
    114144651 (pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114144651 (pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114144651 (pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114144651 (pik3cd)
   04625 C-type lectin receptor signaling pathway
    114144651 (pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114144651 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    114144651 (pik3cd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114144651 (pik3cd)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114144651 (pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114144651 (pik3cd)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     114144651 (pik3cd)
Membrane trafficking [BR:xco04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114144651 (pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4135
Other DBs
NCBI-GeneID: 114144651
NCBI-ProteinID: XP_027873518
LinkDB
Position
1
AA seq 1041 aa
MPPGKYGTQEEWEQDGDQEIFMDFLLPTGIFLKFPVSRNDTIRNIKKMVWKNASREAMFC
GLRDPDLYVFTCINQTAEREELEEESRRISDVRPFMCVLRLVAREGDRGEKLTNTQISLL
IGKGLHEFEAQKNHEVDEFRTKMRTFCEEKSLDRQNLPWQRWMEYSFPCELEPCSSPAAG
GSSKSKHGKKLFVNVKFESSDESFMLQQDSQDLPVALMKSALKKKATVFRSVRQEPEDYT
LQVNGRWEFIYGQHPLGQFKYIFSCLRNGQNPQLTMVHHCTISKYQEDQGRVCSQMYKTR
SLSRPPPLPLKKQNTSSLWSINEPFYIHLLQGSRVNADEGMKLVVQAGLFHGSELLCKMM
TSSEVTVCSEPSWDQRLEFDINVSDLPRMSRLCFALYAIIEKTKKPRGTKKKNKKADCPI
AWVNTMLFDYKDQLKTGEFLLSMWPSVPDDKSDLLNPMGTVQRNPNVDSAAGLLIRFPNI
RPHPLYYPPLDKTIEPEMNGNTVFPSKDEYLKLKEIMDNKNYTEFFEDEKELLWKLRAEV
RDYFPECLSKLLLITKWNKREDVAQMVGLLKSWPELPAIHALELLDYSFPDPAVRSFTIR
CLKKLSDDELLQYLIQLVQVLKYESYLDCDLTTFLLERALSNRRIGHFLFWHLKSEIHVA
SVSLRFGLILEAYCRGNIHHIKLLSKQNEALGKMKALSDIVKTGSQKMTVDDLKLCIRQE
SYLEALSDLLSPLNPSVILFEICTDKCRFMDSKMKPLWLMYKNPLEQADMVGIIFKNGDD
LRQDMLTLQMIRLMENLWKKEGLDLRMIPYGCLSTGNKTGLIEVVKSSDTIANIQRNSSN
SAATAAFNKDALLNWLKSKNPGDKLDQAIEEFTLSCAGYCVATYVLGIGDRHNDNIMIRE
TGQLFHIDFGHFLGNFKRKLGINRERVPFILTYDFVHVIQQGRTNNSEKFERFREYCERA
YKILCRNGTLFVNLFAMMKAAGLPELSSSKDIQYLKDSLALGKSEDEALKNFKVKFNEAL
RESWKTKVNWMMHSLAKDNRP
NT seq 3126 nt   +upstreamnt  +downstreamnt
atgcccccggggaagtatgggacgcaggaggagtgggagcaggacggagaccaggagatc
ttcatggacttcctgctgcccaccgggatcttcctgaaattccccgtgtctcgaaacgac
accatcagaaacatcaagaaaatggtttggaaaaacgccagtcgcgaggctatgttctgt
ggactgcgtgatccggacctgtacgtcttcacctgcatcaaccagacggcagagcgggag
gagctggaggaagagtcgaggaggatcagcgacgtgcggcctttcatgtgtgttttgagg
ctggtggcgagggagggggaccgcggcgagaagctcaccaacacccagatcagtctgctc
atcggcaaaggtcttcacgagttcgaagcccagaagaaccacgaggtggacgagttccga
accaagatgcggacgttttgcgaggagaagtccctggatcggcagaatttgccgtggcaa
cggtggatggagtacagcttcccgtgcgagcttgagccgtgcagctccccggcggccggc
gggagctccaaatcaaagcacggcaaaaagctcttcgtcaacgtcaagtttgagtcgagc
gatgaaagcttcatgctgcagcaggactcccaggatctccctgtggctctgatgaagagc
gctctgaaaaagaaggccaccgtcttccgctcggttcgacaggaacccgaggactacacc
ctgcaggtcaacgggagatgggagttcatctacgggcaacacccgctgggccagttcaag
tacattttctcctgtttgaggaatggtcagaacccccagcttaccatggtgcaccactgc
accatcagcaaataccaggaggatcagggcagagtgtgcagccagatgtacaagacccgc
tccctgtccagaccgccacctctgcccctgaagaagcagaacacctcctccctctggtcc
ataaatgagcccttctacattcacctccttcaggggagcagagtcaatgcagacgagggg
atgaagctcgtggtgcaggccggcctcttccacggcagcgagctcctgtgcaagatgatg
acgagctcggaggtcacggtgtgctccgagccgtcgtgggaccagaggctggagtttgac
ataaacgtgtccgacctgccgcgcatgagccgcctttgcttcgcgctctacgccatcatc
gagaagaccaagaaaccccgcggcacgaagaagaagaacaagaaagcagactgtccgatt
gcctgggtaaacaccatgctgttcgactacaaggaccagctgaagaccggggagttcctc
ttgtccatgtggccatctgtacctgatgacaaaagtgacctgctgaacccgatgggaacg
gtccagaggaatcccaacgtagacagcgccgccggactcctcattcgcttccctaacatc
cggccccatccgctctactatcctccccttgacaagaccatcgagccagaaatgaacggc
aacactgtttttccctccaaagacgagtacttgaaactaaaagaaatcatggacaacaaa
aactacaccgagttttttgaggatgagaaagagctcctgtggaagctccgagccgaggtc
cgcgactatttccccgagtgcctgtccaagctgcttctcatcactaagtggaataagcgt
gaggatgtagctcagatggtgggtttactgaaaagctggcctgaactccctgccatccac
gccttggagctgttggactacagctttcctgatccagcagtccggtccttcactatcaga
tgcctcaagaagctcagtgacgatgagctgctgcagtacttgatccagctggtccaggtc
ctgaagtacgagtcctacctggactgcgacctcaccaccttcctgctggagagggcgctg
tccaacaggaggataggacactttctgttttggcatcttaaatctgagattcacgtagca
tcggtcagtttacgttttggcttgattctggaggcttactgcaggggaaacatccaccac
atcaagcttttgtccaaacagaacgaggctctgggtaaaatgaaggccctgagcgacatc
gtcaagacgggctcccagaaaatgacggtggacgacctgaagctgtgcatcaggcaggag
tcgtacctggaggcgctgtcggacctgctgtcgccgctcaaccccagcgtcatcctattt
gagatctgcactgataagtgcagatttatggattcaaagatgaagccgctctggcttatg
tacaagaaccctttggaacaagcagacatggtcggcatcatcttcaaaaacggagacgat
ctccggcaggacatgttaaccctgcagatgatccggctcatggagaacctgtggaagaaa
gaaggcctggatctcaggatgatcccatacggctgcctgtccaccgggaacaaaacgggg
ctcatcgaggtcgtgaagagctccgacacgatcgccaacatccagaggaacagcagcaac
agcgcggccaccgctgccttcaacaaggacgccttgctcaactggcttaagtccaagaat
ccaggggacaaactcgatcaagcgatagaggagttcactctctcctgtgctggctactgt
gtagctacttacgtgctggggattggagatcgccacaatgacaacatcatgatcagggaa
actggacagctgtttcacattgatttcggacacttcctgggaaacttcaagcggaaactc
gggatcaacagggagcgtgtgccttttatcctgacgtacgactttgtccatgtgatccag
caaggcaggacgaacaacagtgagaagtttgaaaggttcagggaatactgtgagcgggcc
tacaagatcctgtgtcgaaacgggacgctgtttgtcaacctcttcgccatgatgaaggca
gcggggctgccggagctctcctcctccaaagatatccagtatttaaaggattctttagct
ctgggcaaatcggaggacgaagcactgaagaatttcaaagtgaagttcaacgaagctttg
cgggagagctggaagacgaaagtcaactggatgatgcactccttggccaaggacaacagg
ccgtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114145908
Entry
114145908         CDS       T05908                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114145908
   04370 VEGF signaling pathway
    114145908
   04068 FoxO signaling pathway
    114145908
   04070 Phosphatidylinositol signaling system
    114145908
   04150 mTOR signaling pathway
    114145908
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114145908
  09143 Cell growth and death
   04210 Apoptosis
    114145908
   04218 Cellular senescence
    114145908
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114145908
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114145908
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114145908
   04625 C-type lectin receptor signaling pathway
    114145908
  09152 Endocrine system
   04910 Insulin signaling pathway
    114145908
   04914 Progesterone-mediated oocyte maturation
    114145908
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114145908
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114145908
Membrane trafficking [BR:xco04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114145908
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Mod_r Transcrip_act Exonuc_VII_L GrpE
Other DBs
NCBI-GeneID: 114145908
NCBI-ProteinID: XP_027875382
LinkDB
Position
6
AA seq 519 aa
MRDAASAPEQQPKLDLSSQKKKVVVFLKKIFFESKRKENKCNWDYCRKTGMVYPPEGLFY
IEMDQAPPALPPRSTKPTMNNNNCLSPPVCSLQDAEWYWGDITRDEVNEKLRDTPDGSFL
VRDASTKLQGDFTLTLRKDGHNKLIKIYHHDGKYGFSDPFTFTSVVELIWYYQHHSLVEY
NAMLDLMLMHPVSRFQQVSEVKEDSVDVAGRKLKEVHNQYQEKSKEFDRLYEAFTKTSQE
IQMKRTAIEAFNEAMLIFEEQCREQERYGEEFERNSLSEGADNDLESFLINYEKLKCRLG
EIYDSKLHLEDDLRTQVEDYRETDRKINNLRPDLIQLRNIRDLYLNWLNHKGVRQKRIND
WLGIHNDSLDDTYVLKGDEKNLPHQDEASWFVGELSRTQAEEMLQGKVSGTFLIRESSKQ
GCYACSVVVSEEVKHCMIYSTSHGYGFAEPYDAHCSLKDLVLHYHLHSLAQHNDALDVRL
LHPVHAKAADPASQHSDEHKLLQTPKHVPPGLPPAAPEM
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgcgggacgctgcgtctgcaccggagcagcagcctaaattagatctttcatcgcaaaaa
aaaaaagttgttgtctttttaaaaaaaatattttttgaaagcaagcgtaaagaaaacaag
tgcaactgggactactgccgtaaaacaggaatggtttatcctcccgaaggtttattctat
atcgaaatggatcaagcaccaccagctcttcctccccggtccacaaagccaacgatgaac
aacaacaactgcctttctccacctgtgtgttcgcttcaggacgccgaatggtactgggga
gatataacaagggacgaggtgaacgagaagcttcgcgacacacctgacggctccttcctg
gtgcgggacgcgtccacgaagctgcagggagattttactttgactttacggaaagacgga
cacaacaagctaatcaagatctaccaccatgacgggaagtacggcttctcggaccccttc
acgttcacgtcggtggtggagctcatctggtactaccagcaccactcgctggtggaatac
aacgccatgctggacctgatgctcatgcatcccgtgtcccgtttccaacaggtcagcgag
gtgaaagaagacagcgttgacgttgcggggagaaagctcaaagaggtccacaatcagtac
caagagaagtcaaaagagttcgaccgtctttatgaagccttcaccaagacctcgcaggag
atccagatgaagcgcacggcaatagaggccttcaacgaggcaatgctgatcttcgaggag
cagtgtcgcgagcaggagcgatacggagaggagttcgagaggaacagtctatcggaggga
gccgacaatgatttggagagctttctgatcaattacgaaaagctgaagtgccgacttgga
gagatctacgacagcaagctgcacctggaggacgacttgaggacgcaggtggaggactac
agagagacggacaggaagatcaacaacttgcggccggacctcatccagcttcgcaacatc
cgagacctgtatctcaactggcttaatcacaaaggagtacggcagaaacgcataaatgat
tggcttgggatacacaacgacagccttgatgacacatacgtattgaagggagatgagaag
aacctaccacatcaagacgaggcgagttggttcgttggggaactgagtcgaacgcaggcg
gaggagatgcttcaaggcaaagtttccggaacgttcctgatccgagagagcagcaagcag
ggatgctacgcctgctctgttgtcgtgagcgaagaggtgaagcactgcatgatatacagt
acttcccacggctacggcttcgccgagccctacgacgcccactgctcgctcaaagacctc
gtcctgcactaccacctccactccctagcgcagcacaatgacgccctggacgtccggctg
ctgcaccccgtgcacgccaaggcggcggaccccgcttcccagcactccgacgagcacaaa
ctgttacagactccaaaacacgtgccaccgggactcccgcccgcagccccggagatgtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114146103
Entry
114146103         CDS       T05908                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114146103
   04370 VEGF signaling pathway
    114146103
   04068 FoxO signaling pathway
    114146103
   04070 Phosphatidylinositol signaling system
    114146103
   04150 mTOR signaling pathway
    114146103
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114146103
  09143 Cell growth and death
   04210 Apoptosis
    114146103
   04218 Cellular senescence
    114146103
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114146103
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114146103
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114146103
   04625 C-type lectin receptor signaling pathway
    114146103
  09152 Endocrine system
   04910 Insulin signaling pathway
    114146103
   04914 Progesterone-mediated oocyte maturation
    114146103
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114146103
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114146103
Membrane trafficking [BR:xco04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114146103
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 SH3_2 Laminin_I Cupin_8 DUF4188
Other DBs
NCBI-GeneID: 114146103
NCBI-ProteinID: XP_027875678
LinkDB
Position
6
AA seq 729 aa
MATDGFQYRVLYTFTKDQEEDLDLQPGDLLTVSKASLMSVQSYEEGFEEHPERLGWILGY
NERTMQRGDFPGTFVEFVGPIKMAHPSSQPRSQRPLPAAPIPEPSQAVPVPDLSQQFTPP
ETAPPDLISLIQAIEHRGLDSKILYRTASTSDSSVYTPSTEGDAAQSDVGFLSESVLCCL
RDLPSPVIPACIYPQLQTAVMQQLLHQQSLDGAVAGSHDREVSLVLENTTVVPLHHRLTL
QYLLTHLTKVLQAQASNGLDTHTLGRIFGPLLIRTSPSNQGYSWEEDFPVLVVERLLVER
TAQQDFDPPVLPAKPTKSRIAPSDMTDTSSLLNDAEWYWGEISREEVNEKLRDTPDGTFL
VRDASSKLEGEYTLTLRKGGNNKLIKIYHQEGRYGFSEPLTFQSVVELINHYRHESLAQY
NAKLDTKLLYPISKFQQLVKENSIEEVGEQLKVYHEQYQEKSREYDSLYDEYTRTSQELQ
MKRTAIEAFNETIKIFEEQFETQEKYSRESLERFQREGNEKEIQKIQSNSERLKSRVKEI
HDSKRKLEQDLKQQVSDNREMDKKMNSLKPDLMQLRKIRDQYLIWLTQKGTRQKKINEWL
GIKIDADDSYSLEEDDSSPHHDDCTWYVGDIKRSQAEEMLRDKCDGTFLIRESQSQKGSY
ACSVVVDGDTKHCVIYKTATGYGFAEPYNLYSSLQELVLHYKNVSLAQHNDHLNVNLAYP
VLARSQNLK
NT seq 2190 nt   +upstreamnt  +downstreamnt
atggcgacagatggtttccaataccgtgtgctctacacatttaccaaggaccaggaagag
gacttggacctgcagccaggggacctcctgactgtcagcaaggcctctctgatgtcagtg
cagagctacgaagagggctttgaggagcacccggagcgtctaggctggatcctaggatac
aacgaacgcaccatgcagagaggcgacttcccagggaccttcgtcgaatttgttggtccc
atcaaaatggcacatccatcaagtcaaccaaggtcccagcgacctctcccggctgctccc
ataccagaaccatctcaagctgttccagtgccagacctcagccagcagttcactccacca
gagacggctcccccagacctgatcagcctcatccaagccatcgaacacagaggtctggac
agcaaaatattgtacagaacagcaagcacatcagacagctcagtgtataccccgagcact
gaaggcgatgctgctcagagtgacgtgggtttcctgtctgagagtgtcctgtgctgcctg
agagacctcccatcacctgtcatccctgcatgcatctatccgcaacttcaaactgcagtg
atgcagcagctgcttcaccagcagtctctagatggagctgttgctggtagccatgacaga
gaagtgagtctggttctggagaacaccaccgtggtcccgctccaccatcgtctcaccttg
cagtacctgctcacacatctaaccaaggtgctccaggctcaggccagtaacggcctggac
actcacactctgggaaggatctttggccccctcctgattcggacaagcccctcaaaccaa
gggtattcatgggaagaggactttcccgtcctggtggtggagaggctgctggtcgagaga
actgcacaacaagacttcgatcctcctgttcttccagcaaaaccaaccaaatcaagaata
gccccatcagatatgacggacacaagcagcctgctgaacgatgctgagtggtactgggga
gaaatttccagagaggaggtaaatgagaaactgcgagatactccggatggaacctttctg
gtgcgagatgcttccagcaaactggagggcgagtacacgctgactctcaggaaagggggg
aacaacaaactgatcaagatttaccaccaggagggtcgctatggcttctcagagcctttg
accttccagtctgtggtggagctcatcaatcactaccgccacgagtccctggctcagtac
aacgccaaactggacaccaagctgctctaccccatctccaagttccagcagttggttaag
gagaacagcatagaggaggtgggagagcagctcaaggtctaccatgagcagtaccaggag
aagagccgcgagtacgactctctgtatgacgagtacactcgcacctcacaggagctgcag
atgaagcgaacagccattgaagcctttaatgaaaccatcaagatctttgaagaacagttt
gagacccaggagaaatacagccgagagtctttggagcgattccaaagagagggcaacgag
aaggaaattcaaaagattcagagcaactctgagcgtttgaagtcacgcgtgaaggaaatc
cacgacagcaagcgaaaactggagcaagacctgaagcagcaggtgtctgacaacagagag
atggacaagaagatgaacagcctcaagccagatctcatgcagcttcgcaagatcagggac
cagtacttaatatggttgacacagaagggaacaaggcagaagaagatcaatgaatggctg
ggcataaagatcgatgctgatgactcctattctctggaggaagatgacagctcacctcac
catgacgattgtacctggtatgtaggtgacatcaagcgctcccaggcagaggaaatgttg
agagacaaatgtgatggaacctttctcatcagggaaagccaatcacagaagggctcttat
gcctgttctgttgttgttgatggcgacacaaagcactgcgtcatctacaagacagccaca
ggttatggatttgctgagccctacaatctgtactcgtctctccaagaactggtactccac
tacaaaaacgtctccttggcccaacacaacgaccatctgaatgtaaatctagcttatcca
gtcttggcccgctctcagaacctgaagtag

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114146763
Entry
114146763         CDS       T05908                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00562  Inositol phosphate metabolism
xco01100  Metabolic pathways
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114146763
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114146763
   04370 VEGF signaling pathway
    114146763
   04068 FoxO signaling pathway
    114146763
   04070 Phosphatidylinositol signaling system
    114146763
   04150 mTOR signaling pathway
    114146763
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114146763
  09143 Cell growth and death
   04210 Apoptosis
    114146763
   04218 Cellular senescence
    114146763
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114146763
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114146763
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114146763
   04625 C-type lectin receptor signaling pathway
    114146763
  09152 Endocrine system
   04910 Insulin signaling pathway
    114146763
   04914 Progesterone-mediated oocyte maturation
    114146763
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114146763
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114146763
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114146763
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     114146763
Membrane trafficking [BR:xco04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114146763
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 C2 DUF5314
Other DBs
NCBI-GeneID: 114146763
NCBI-ProteinID: XP_027876897
LinkDB
Position
6
AA seq 1068 aa
MPPRPSSGELWGMHLMPPSILVDCLLPNGMILTLECLREATLITVKHDLFKEARKYPLYH
LLQEESSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGFA
IGMPICEFDLVKDSEVQDFRRNILNVCKEAVDLRDSNGSHSRALYVYPPNVESSAELPRH
IYNKLDKGQIIVVIWVIVSPSNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLTQEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMSKESLYSQLPME
NFTMPSYARRISTATPYMNGETATKCLWTINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTQRVPCSNPRWNEWLTYDMYVTEIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVAGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDHF
SCPVKFPDMSMIEDHANWNISRELGFNYSHPGLSNRLARDKPLTESDNEQLRQVCNRDPL
SEITEQEKDFLWSHRHYCINIPDILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNFPDPMIREFAVKCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLLK
QEKKDEAQKVQMKFLVEQMKRPDYMDALQSFTSPLNPAHQLGNLRLEECRMMSSAKRPLW
LNWENPDMMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHALHQWLKDKNKGEMYDQAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKSEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccccggccctcttccggagaactatgggggatgcacttgatgccccccagcatc
ctagtggactgcctgctgccaaacggcatgatcctcacgttggagtgcctccgggaggct
acgctcattacggtcaagcacgatctcttcaaggaagccaggaagtaccccctctaccat
ctgctgcaggaggagagctcctacatcttcgtcagcgtcacgcaggaggccgagcgcgag
gagttttacgacgagaccaggaggctgtgcgatctcaggctcttccaggctttcctcaaa
gttatcgagccagtgggcaacagagaggagaaaatcctcaacagagaaataggcttcgcc
atcggaatgcccatatgcgagtttgatttggtgaaggactccgaagtgcaggacttcaga
aggaacattttaaatgtttgcaaagaagccgtggacctcagagacagcaacggctcccac
agcagagcgctgtacgtctacccgcctaacgtggaatcgtccgcagagcttcccaggcac
atctacaataaactagataaaggccagattatcgtggtgatctgggtcatcgtttctccc
agcaacgacaagcagaagtacaccctgaagatcaaccacgactgcgtgcccgagcaggtg
atcgccgaagccatccggaagaagacgcgcagcatgctgctcactcaggagcagctgaag
atgtgcgtccaggagtaccaggggaagtacatcctcaaagtctgcggctgcgacgagtac
ttactggagaaataccccctgagtcagtacaagtacatccgcagctgcatcatgctggga
aggatgcccaacctgatgctgatgtccaaagagagcctgtattcccagctgcccatggag
aacttcaccatgccgtcgtacgccaggcggatctccacggcgacgccctacatgaacggc
gagacggccaccaagtgtctctggacaatcaacgggacgctgaggatcaggatcctctgc
gctacctacgtcaatgtaaacatcagagacatagacaagatctacgtcaggactgggatc
taccatggtggggagcagctgtgtgacaacgtcaacactcagcgcgttccctgctctaat
cccaggtggaacgagtggctgacctacgacatgtacgtcacagaaatccccagagccgct
cgactctgcctctccatctgctccgtcaaaggaaggaagggagctaaagaggaacattgt
cccctggcctggggcaacatcaacctgtttgactacacacacacgctggtagcggggaag
atggctctcaacctgtggcctgtcccacatggcctggaggatctgctcaaccccatcggt
gtcacaggctccaaccccaacaaggaaaccccttgcttggagctggagttcgaccacttc
agctgcccagtcaaattccccgacatgagcatgatcgaggatcacgccaactggaacatt
tcccgggagctcggctttaattactcacaccccggcttgagcaaccggctggcacgagac
aaacccctgactgagagcgataatgagcagctgcgccaagtgtgtaaccgggaccctctg
tctgagatcactgagcaggagaaggactttctgtggagtcacagacattactgcatcaac
atcccagatatccttcccaagatcctcctggctgtgaagtggaactctagagacgaggtc
gcacagatgtattgccttctcaaagactggcctgccattaagccagaacaagccatggag
ttgctggactgcaacttccccgaccccatgatccgagagttcgccgtgaagtgccttgag
aaatacctaaccgacgacaaactgtcgcagtacctcatccagctggtccaggttctgaag
tacgagcagtacctggacaacccgctcgcacgcttcctgctgaaaaaggctttgaccaat
cagaggataggacacttcttcttctggcatttaaaatcagagatgcacaacaagacggtg
agccagcgcttcggcctcctgctggagtcgtactgccgggcgtgcggcatgtatctgaag
cacctgagccggcaggtggaggccatggagaagctcatcaatctcaccgacctgctcaag
caggagaaaaaagacgaggcgcagaaggtccaaatgaagtttctggtcgagcagatgaag
aggcctgactacatggatgcactacagagctttacctctccgctcaacccggcacatcag
ctgggaaacctccgcctggaggaatgtcggatgatgtcatcggcaaagcgacctctctgg
ctgaactgggaaaacccagacatgatgtccgaactcctcttccagaacaacgaaatcatc
ttcaaaaatggagacgatctgaggcaggacatgctgacgctgcagatcattaggataatg
gagaacatctggcagaaccagggccttgatctcaggatgctgccgtacggctgcctgtct
atcggcgactgcgtggggttgatcgaagtggtgaggaactctcacaccatcatgcagatc
cagtgcaaaggaggcctgaagggggcgctgcagttcaacagccacgctctgcaccagtgg
ctcaaggataagaacaagggggaaatgtacgaccaggccatcgatctgttcacccggtcg
tgcgccggctactgcgtggccaccttcatcctcggcattggagacagacacaacagcaac
atcatggtgaaagacgacggacagctgttccacatcgacttcggccatttcctcgaccat
aaaaagaagaagttcgggtacaagagagagcgggtcccgtttgttctcacgcaggacttc
ttgatcgtcatcagcaaaggaacgcaagagtgtacaaaaaccagagagttcgaaagattc
caggagatgtgctacaaggcgtacctggccatccggcagcacgccaacctcttcatcaac
ctgttctccatgatgctgggctcaggcatgccagagctgcagtcgttcgacgacatcgcc
tacatcaggaagaccctggccctggacaagtccgagcaggaggcgctcgactacttcatg
aagcagatgaacgacgcccatcacggcggctggaccaccaagatggactggatcttccac
accatccgccagcacgccatgaactga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114149262
Entry
114149262         CDS       T05908                                 

Gene name
pik3r1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114149262 (pik3r1)
   04370 VEGF signaling pathway
    114149262 (pik3r1)
   04068 FoxO signaling pathway
    114149262 (pik3r1)
   04070 Phosphatidylinositol signaling system
    114149262 (pik3r1)
   04150 mTOR signaling pathway
    114149262 (pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114149262 (pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    114149262 (pik3r1)
   04218 Cellular senescence
    114149262 (pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114149262 (pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114149262 (pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114149262 (pik3r1)
   04625 C-type lectin receptor signaling pathway
    114149262 (pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114149262 (pik3r1)
   04914 Progesterone-mediated oocyte maturation
    114149262 (pik3r1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114149262 (pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114149262 (pik3r1)
Membrane trafficking [BR:xco04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114149262 (pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 Laminin_I T6SS_VasJ Lant_dehydr_C SH3_2 SH3_9 RNA_binding
Other DBs
NCBI-GeneID: 114149262
NCBI-ProteinID: XP_027880764
LinkDB
Position
8
AA seq 727 aa
MSVEGYQYRALYEYKKEREEDIDLHVGDILLVSKGALVALGYSDGLEQQPQKIGWLPGFN
ETTQEKGDFPGTYVEYVGKKWVSPPTPKPRPLRPLPVAPGSFKAEDSDSDQGVCLADLTE
QFFLPETAPPLLTRLLEAIERKGADNPTLYRTFTAGGGLEVRQYYDCDPPAAELDQLELP
TLCDGLRRYLQDLPQPVVPAALHAQMVHAVKEAANPEECAQLLRRIASSPTLPPQYWLAL
QCLLRHFSRVCQNAPKNQLSARSLGEIFSPVFFRQQPTSCEPSLDAFIKIIEVLVTSEWS
ESQAAPALPPKPPKSTAVTNNGMNNNMALQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPK
LDVKLLYPVSKHQQDQVVKEDNIEAVGRKLCEYHQQYQEKNKEYDRLYEEYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNDKEIQRIMGNYEKLKSRISEIV
DSKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
IKNENTEDQYSMVDDDEDLPHHDERSWKLGNINRLQAEAVLQGKRDGTFLVRDSSKAGCY
ACSVVVEGEVKHCVINKTPSGYGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVTLAYP
VYAQQRR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgagcgtggaaggataccagtacagagcgttgtacgagtacaagaaggagcgggaggag
gacatcgacctgcacgtgggggacatcctgctggtgagcaagggagccctggtcgccctc
ggttacagtgacggcttggagcagcagccgcagaagatcggctggctgccgggcttcaac
gaaaccacgcaggagaagggcgacttccccgggacgtacgtggagtacgtggggaagaag
tgggtctcgccgccaacgcccaagccgaggccgctcagacccttacctgtagctccaggt
tccttcaaggcagaggactccgactcggatcaaggcgtctgtttggcggacttgacggag
cagtttttcctccctgagaccgccccgcccttgctgaccagactcctggaagctatcgag
aggaaaggtgcggataacccgactctgtatcgcacgttcaccgctggaggtggactcgaa
gtcaggcagtattatgattgtgatcctcccgccgccgagctggaccagctggagctgccc
accctgtgcgacggcctgcgcaggtacctgcaggatctgccccagcccgtcgtcccggcc
gccctccacgctcagatggtccacgccgtcaaagaggcagcgaaccccgaggaatgcgcc
cagttgctgcgccgcatcgccagctccccgaccctgccgccccagtactggctcgccctg
cagtgtctgctcaggcacttctctagagtctgccagaacgcgcccaagaaccagctcagc
gccagatcgttgggcgagatcttcagccccgtgtttttcaggcagcagcccaccagctgc
gaacccagtctggatgctttcatcaagatcattgaggtgctggtgaccagcgagtggagc
gagagccaagcagctccagctctacctccaaaaccacccaagtccacagctgtgactaac
aacggtatgaacaacaacatggctcttcaggacgccgaatggtactggggggacatctct
cgggaggaagtcaatgagaaactgagggacactgcggacggtacgtttttggtgcgggac
gcctcgactaaaatgcacggagactacactctgacgctgaggaaaggaggcaacaacaag
ctcatcaagattttccaccgcgacggaaagtacggcttctcggatccgctgaccttcagc
tccgtcgtagagctcatcaaccactatcggaacgagtcgctggctcagtacaaccccaag
ctagacgtcaagctgctttacccggtctccaaacaccagcaggaccaggtggtgaaagag
gacaacatcgaagctgtggggaggaagctttgtgaataccaccagcagtaccaagagaag
aacaaagaatacgaccgtctgtacgaggaatacaccagaacgtcacaggaaatccaaatg
aaacgcacagcgatagaagcctttaacgaaaccattaagatatttgaggagcaatgtcag
acgcaagagcggtacagcaaagagtacatcgagaagttcaagagagaaggcaacgacaag
gagatccaaagaatcatgggtaactacgaaaagttgaaatcgaggatcagcgaaatcgtc
gacagcaagcgcaggctggaggaagacctgaagaagcaggcggcggactacagagagatc
gacaagagaatgaacagcatcaaacccgacctcatccagctccgcaagaccagagaccag
tacctgatgtggttgacacagaaaggagtccgacagaagaaactcaacgaatggctagga
atcaagaacgagaacaccgaagatcaatactcgatggtggacgacgacgaagacctcccg
catcacgacgaacgcagctggaaactgggcaacatcaaccggctccaggccgaggctgtg
ctccaaggcaagagagacggaacattcctggttcgggacagcagcaaagcagggtgctac
gcctgcagcgttgtcgtggaaggcgaggtgaagcactgcgttatcaacaagacgccgtcg
ggctatggcttcgccgagccgtacaacctgtacggctcattgaaagaacttgtactccac
taccagcacacgtctttggtccagcacaacgactctctgaacgtgacgctagcgtatccg
gtgtacgcccagcagagacggtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114150541
Entry
114150541         CDS       T05908                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00562  Inositol phosphate metabolism
xco01100  Metabolic pathways
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114150541
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114150541
   04370 VEGF signaling pathway
    114150541
   04068 FoxO signaling pathway
    114150541
   04070 Phosphatidylinositol signaling system
    114150541
   04150 mTOR signaling pathway
    114150541
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114150541
  09143 Cell growth and death
   04210 Apoptosis
    114150541
   04218 Cellular senescence
    114150541
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114150541
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114150541
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114150541
   04625 C-type lectin receptor signaling pathway
    114150541
  09152 Endocrine system
   04910 Insulin signaling pathway
    114150541
   04914 Progesterone-mediated oocyte maturation
    114150541
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114150541
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114150541
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114150541
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     114150541
Membrane trafficking [BR:xco04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114150541
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 DUF2321 Ribosomal_S15
Other DBs
NCBI-GeneID: 114150541
NCBI-ProteinID: XP_027882794
LinkDB
Position
9
AA seq 1074 aa
MPPRPSSGELWGIHLMPPRILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDPEVQDFRRNILNVCKDSVELRNASGPHSRALYVYPPSVESTQELPKH
IYSKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPISQYKYIRSCIMLTRMPNLMLMAKDSLYTQLPTD
NFVMPSYSRRISTATSYMNGEASSKSLWSINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQMCDNVNTQRVPCSNPRWNEWLPYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVANKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDHF
SCPVKYPDMNAVEDHANWIISRELGFNFNLSVNHSGTQQSSRVARDHALTESDSEQMRQL
SNRDPLSEITEQEKDFLWRHRHYCMNIPEILPKILLAVKWNSRDDVAQMYCLLKEWPSIR
PEQAMELLDCNYPDPMVRHFAVRCLDKYLTDDKLSQYLIQLVQVLKYEQYLDSPLARFLL
KKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLEAYCRACGMYLKHLSRQVEAMEKLIN
LTDILKQEKKDETQKVQMKFLVDQMKRPDYMDALQSFTSPLNPAHQLGNLRLEECRIMSS
AKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRML
PYGCLSLGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSNTLHQWLKDKNKGETYDMAV
DLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPF
VLTQDFLIVISKGSQECTKTKEFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQ
SFDDIAYIRKTLALEKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHALN
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgcctccaaggccgtcctcaggggagctatggggcatccacctgatgcccccaaggatc
ctagtggactgcctgctgcccaatgggatgattctgaccttggagtgtctccgagaggcc
acgctaatcaccatcaagcatgagttgttcaaggaggccagaaaatatcccctccatcac
ctcctgcaggaggaaacctcctacatttttgtcagtgttacacaggaagctgagcgggag
gagttctacgatgagactcgaaggctgtgtgaccttcgactcttccagcctttcctcaaa
gtgatcgagccggtcggcaacagagaggaaaagatcctgaacagagagatcggttttgcc
atcggcatgcctgtgtgtgagttcgacctggtgaaggacccagaggtccaggacttcagg
agaaacatcctgaatgtttgtaaagactctgtggagctgagaaacgccagcggtccccac
agcagagcgctgtatgtttacccccccagcgtcgagtcgacacaggaacttcccaaacac
atctatagcaaactggacaaaggtcagattattgttgtaatatgggtgatcgtttcccca
aacaatgacaagcaaaagtatacactaaagatcaaccatgactgtgtgccggaacaggtg
attgcagaggccattcgcaagaagacgcgcagcatgctgttgtccccagagcagctgaag
atgtgtgttcaagaatatcagggaaaatacatcctcaaagtttgtggctgtgacgaatac
ttgctggaaaagtatcccataagccagtacaagtacatccgtagttgcatcatgttgacc
aggatgccaaacctgatgctaatggctaaggacagcctgtacactcagctgcctactgat
aacttcgtcatgccatcatactctcgacgtatctccacggcaacgtcgtacatgaatgga
gaggcttcgtccaagtcgctgtggagcatcaatgggactctgcgaatacgaatcctctgc
gccacctacgtcaacgtgaacatacgggacatagacaagatttatgtgaggactggaatt
taccatggaggtgaacaaatgtgtgacaacgtcaacacacagagagtaccctgctctaat
cccaggtggaatgagtggctcccgtatgacatgtacatcccggacatcccccgagctgcc
aggctctgcctctccatctgctctgttaaaggcagaaagggagccaaggaggaacactgt
ccactagcttggggcaacattaacctatttgactacactcacactctggtggccaacaag
atggctctgaacctctggccagtccctcatggccttgaagacctcctcaacccaatagga
gtcactggatctaatcccaataaggaaacgccatgtctggagctggagtttgaccacttc
agctgtcctgtcaaatacccagacatgaatgcagtggaagatcatgcaaactggatcatc
tccagggaactggggtttaacttcaatctctcagtcaaccactcgggaactcaacagagc
agtcgggtggccagagatcacgccctgacggaaagcgacagcgaacagatgcgacagctg
agtaacagggaccctctgtctgaaatcactgagcaggagaaagacttcctctggagacac
aggcattactgtatgaacatcccagagatccttcccaagatacttcttgctgtcaaatgg
aactccagagatgatgtagcgcagatgtattgtttgttgaaggaatggccatcgatccgt
ccagaacaggccatggagctgctggactgtaattacccagaccccatggtcagacacttc
gctgtacgctgccttgacaaatacttgaccgacgataaactctcccagtaccttatccag
cttgttcaggtattaaaatacgagcagtatcttgacagtccgctagctcgctttctcctc
aaaaaggccctgaccaatcaaaggataggccatttcttcttctggcatctcaagtcagaa
atgcacaacaaaactgtgagccagaggtttgggctgctgctggaggcttactgcagggct
tgtggcatgtacctcaaacacctgagcaggcaggtggaagccatggagaagcttatcaac
ctcaccgacatactcaaacaggaaaagaaggatgagacacaaaaggtccagatgaagttt
cttgtagaccagatgaagagacccgactacatggacgctctgcagagcttcacctctcca
ctcaaccctgcacatcagctgggaaatctgaggttggaggagtgcaggatcatgtcatcc
gcaaagagaccgctgtggctcaactgggagaatcctgacatcatgtccgagttactgttt
cagaataatgagatcatcttcaaaaacggagatgatttgcggcaggatatgctgacgctg
cagataatcagaatcatggagaacatttggcagaaccagggactggacctacggatgctc
ccctacggctgtctgtctctgggagactgcgtgggcctgatagaggtggttcgaaactcc
cacaccatcatgcagattcagtgtaaaggaggcttgaaaggagccttgcagttcaactcc
aacacgctgcatcagtggctcaaggacaaaaacaaaggagagacgtatgacatggctgtg
gatctgtttacaaggtcctgtgctggctactgtgtagccacgtttattctggggatcgga
gaccggcacaacagcaacattatggtcaaagatgacggacagttgtttcatatagatttt
ggccatttcttggatcacaagaagaagaaatttggctacaagagagagcgagtcccgttc
gtactgactcaagacttcctcatcgtcatcagtaagggatcccaggagtgcacaaagacc
aaagagtttgaaaggttccaggaaatgtgctacaaagcgtacctggccatccgccagcac
gccaacctcttcatcaacctgttctccatgatgctgggctccggcatgcccgagctgcag
tcgttcgacgacatcgcctacatccggaagacgctggcgctggagaaaaccgagcaggag
gctttggattatttcatgaagcagatgaacgatgcccaccatggaggttggaccaccaag
atggactggattttccacacgattcggcagcatgcactaaactaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114150685
Entry
114150685         CDS       T05908                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114150685
   04370 VEGF signaling pathway
    114150685
   04068 FoxO signaling pathway
    114150685
   04070 Phosphatidylinositol signaling system
    114150685
   04150 mTOR signaling pathway
    114150685
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114150685
  09143 Cell growth and death
   04210 Apoptosis
    114150685
   04218 Cellular senescence
    114150685
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114150685
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114150685
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114150685
   04625 C-type lectin receptor signaling pathway
    114150685
  09152 Endocrine system
   04910 Insulin signaling pathway
    114150685
   04914 Progesterone-mediated oocyte maturation
    114150685
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114150685
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114150685
Membrane trafficking [BR:xco04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114150685
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 FadA Exonuc_VII_L
Other DBs
NCBI-GeneID: 114150685
NCBI-ProteinID: XP_027883084
LinkDB
Position
9
AA seq 535 aa
MAAESFQLGTDDELQAASSLASLHLRDGIGIGNTGHMENNPEPDAALPVITSPPPDQSQQ
QAEIAPPADQEFLETEKDQNDGEEQACIRTPVPQQLSSHCAQDHENPDLKPTNTSKEGDI
PPENNITKAMAASDISIDNQQLSDAEWYWGNISREEVNEMMRNTPDGTFLVRNASSRIKG
EYTLTLRKDGYNRLVKIFHQGGKCGFSEPLTFPSLVDLIQYYQKKSLAQYNSKLDIRLLY
PVSRYYQHHVMEIDIAAIGEQLRIFQDQYKEKSQEYDHLFKELNQTSQELQSKRTAIEAF
SEIIRIFEEECETQERYSKEYIDMFLTLDSSTKNDNRIQNNSDELQSRVEEIHNSKKMLE
EELRTKALAHMEVDRKITRLKPDLVQLRKIRDQYLLWLTQQGMRQSQINNWFGVRPEEDP
YTLEDDTHEEERSWYVGGMRRKEAEELLKGRRDGTFLIRDSQTQRGSFACSVVVDGDVKH
CVIYRTSTGYGFAEPYNLYSSLRELVLHYRHTSLIQHNKQLNVTLAWPAFSQQSS
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggcagcggagagtttccagctagggacagacgacgagctccaggctgcgtcatcgcta
gcatccctccatctcagggacggcattgggatcgggaacactggccacatggagaacaat
ccagagcccgatgctgcccttcctgtgattacatcaccacctcctgaccaatcacagcag
caagcagagatcgctccaccagcagatcaagagttcctggaaacagaaaaggaccaaaac
gacggcgaggagcaagcttgcattcggacaccggttcctcagcagctctcctcccattgt
gctcaagatcatgagaatcctgacctgaaaccaaccaacactagcaaagaaggagatatc
ccaccagagaacaacataaccaaagcgatggcagcctctgacatcagcattgataatcag
cagctgtctgatgcagaatggtactggggcaacatttcaagagaggaggtaaatgagatg
atgagaaacactcctgatggtacatttctggtacgaaatgcttccagccggattaaaggg
gaatacacgctgactctacgaaaagatggctacaaccgactagtaaaaatcttccatcaa
ggggggaagtgcggcttttctgagccactgacttttccctcactggtagaccttatccag
tactaccagaagaaatcactagcccagtacaactctaagctggatatcaggttactttac
ccagtttccagatactatcaacaccatgtgatggagatcgatattgcagcaatcggagaa
cagctgaggatatttcaggatcaatacaaggagaaaagtcaagagtatgaccatctattt
aaggagctgaaccaaacctcacaggagctccagagtaagcgaacggccattgaggctttc
agtgaaattattcggatctttgaggaggagtgtgaaacccaagaacgctacagcaaggaa
tacatcgacatgttcctcacattagacagcagcacaaaaaatgacaacagaattcaaaac
aactctgatgaactgcagtccagggtggaggagatccacaacagcaagaagatgttggag
gaagaactgaggacaaaagcactggctcacatggaggtcgacaggaaaattactagactg
aagcctgatcttgtacagctcagaaaaatcagagatcaataccttctatggctaacccag
caaggcatgagacagagtcaaattaacaactggttcggtgttagacctgaagaagaccct
tacacccttgaagatgacacccatgaggaagagaggagttggtacgttggaggtatgaga
cgaaaagaggcggaggagctgctgaaaggaaggcgggatgggacattcttgatcagggac
agccagactcagaggggatcctttgcttgctctgttgtcgtggacggagatgtcaaacac
tgcgtgatctacaggacgtctacaggttacggcttcgctgagccctacaacttgtactcg
tcgctgagggagcttgtcctccactaccgccacacatcactgatccaacacaacaagcag
ctgaatgtaaccctggcctggcccgcttttagtcagcagtccagctga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114157035
Entry
114157035         CDS       T05908                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00562  Inositol phosphate metabolism
xco01100  Metabolic pathways
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114157035
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114157035
   04370 VEGF signaling pathway
    114157035
   04068 FoxO signaling pathway
    114157035
   04070 Phosphatidylinositol signaling system
    114157035
   04150 mTOR signaling pathway
    114157035
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114157035
  09143 Cell growth and death
   04210 Apoptosis
    114157035
   04218 Cellular senescence
    114157035
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114157035
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114157035
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114157035
   04625 C-type lectin receptor signaling pathway
    114157035
  09152 Endocrine system
   04910 Insulin signaling pathway
    114157035
   04914 Progesterone-mediated oocyte maturation
    114157035
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114157035
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114157035
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114157035
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     114157035
Membrane trafficking [BR:xco04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114157035
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 PI3K_rbd PI3K_p85B DUF2321 C2
Other DBs
NCBI-GeneID: 114157035
NCBI-ProteinID: XP_027893506
LinkDB
Position
14
AA seq 1070 aa
MVPRPSSGELWGLHLMPPRILVDCCLPNGMMVSLECLRETPLISIKQQLFIEARKYPLYH
LLQEESCYIFVGVTQEAEREEFYDETRRLCDLRLFHPILKVIEPLGNREEKILNREIGFA
IGMPVCEFEMMKDPEVQDFRRSILSVCREAMEEREGGGAHTQALYVYPPNVESSPHLPQH
IYSKLDKGRLIVTIWVIMSPSNSKQKYTLKVSHDSLPEQLIAESIRKKSRSMHLSPQQLR
LCVQEYQGQYILKVCGCDEYLLENFPLSQYKYIRSCIIVGRLPHLMLVSKDSLYSQLPAS
GFVTPSYSRRTPQPSPCPGGGDGSPPRSLWAFNTLLRVRLLCATYVNVNIRDIDKIYVRT
GIYHGGEPLCENVNTQRVPCSNPRWNEWLTYDIYLADLPRSARLCLSICSVKGRKGAKEE
HCPLAWGNVSLFDYMDILVSGKVALSLWPVPHGLEDLLNPIGVAGSNPNKETPCVELEFS
RFNQTVVFPDEQQIEEHANWTISRELGYNYCHGLSSRLACDSSVSATDAEQLRSLCSRDP
LYELSEQEKDFLWRHRHYCLNIPESLPKLLLSVKWNSRDEVSQMYCLLKEWPLMEPESAL
ELLDCNFPDPIVREFALRCLVQGLTDDKLSQYLLQLVQVLKYEMYLDNPLARFLIKKALT
NQRIGHFFFWHLKSEMHNKTISRRFGLLLEAFCRACGMYLKHLNRQVEAMDKLVNLTDTL
KQEKKDETQKTQMKFLVEHMSRPDYMESLQGFVSPLNPVHQLGNLRLEECRIMSSAKRPL
WLNWENPDIMSELLFTNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCL
SIGDRVGLIEVVKNSYTIMQIQCKGGLKGALQFNSNTLHHWIKDKNHGEAYDRAIDLFTR
SCAGYCVATFILGIGDRHNSNIMVKENGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQD
FLIVISKGIQESTKTKEFERFQEMCYKAYLAIRQHASLFINLFSLMLGCGMPELQSFDDI
AYLRKTLALEKSQQEALEYFTKQMNDAHHGGWSTKMDWIFHTIRHMPNEH
NT seq 3213 nt   +upstreamnt  +downstreamnt
atggtgcccaggccatcgtccggggagctatgggggctccatctgatgcccccgcggatt
ctggtggactgctgcctccccaatgggatgatggtgagcctggagtgtctcagagaaact
cctctcatcagcataaagcagcagctcttcatcgaggccaggaagtatcctctctaccac
ctgctgcaggaggagtcgtgctacatctttgtgggcgtgacccaggaggctgagcgggag
gagttttacgacgagacgcggaggttgtgtgacctgcgactttttcaccccatcctgaag
gtcatcgagccactggggaaccgagaggagaagatcctaaaccgagagatcggcttcgcc
attgggatgccggtgtgtgaatttgagatgatgaaagacccagaggttcaggacttccgc
cgctccatactgagcgtgtgcagagaggccatggaggagagagaggggggcggggcacac
acccaggcgctctatgtttacccccccaacgtggagtccagtcctcatctgccgcaacac
atctatagcaagctggacaaagggcggctcattgtgaccatctgggtgattatgtctcca
tcaaactccaagcagaaatacactttaaaggttagccacgacagtttacccgagcagcta
atcgccgagtccatcaggaagaagagccgatcgatgcacctgtcccctcagcagctccgc
ctctgcgtgcaggagtaccagggccagtacatccttaaggtgtgcggctgtgacgagtac
ctgttggaaaatttccccctcagtcagtataagtacatccgctcttgcatcatcgttgga
cgtcttcctcacctaatgctcgtgtccaaagacagcctctactctcagcttccagcctcg
ggtttcgtcactccttcctacagtcggaggacgccccagccgtctccctgtccaggagga
ggtgacggatctcctcctcgctccctctgggcctttaacactctgctcagggtgcgactg
ctctgcgccacttatgtcaacgtcaacatccgggatattgacaagatctatgtgaggacg
ggtatctatcatggaggagagccgctgtgtgaaaacgtaaacacccagagggttccctgc
tccaaccccaggtggaacgagtggctgacctacgacatttacttggcggatcttcctcgc
tcggcaagactttgcctgtccatctgctctgtgaagggaaggaaaggagccaaggaggag
cattgccctctggcctgggggaacgtcagcctgtttgactacatggacatcctggtctct
ggaaaggtggctctgagtctctggcccgtccctcacggccttgaggacctgctgaacccc
atcggagtggccggctcaaaccccaacaaggagaccccctgtgtggagctggagttctca
cgattcaaccagacagtcgtgtttcctgatgagcagcagattgaagaacatgctaactgg
accataagcagagagctgggctacaactactgccatggactgagtagccgcctggcctgc
gacagcagcgtttcagccactgatgcagagcagcttcgctctctttgctccagagatcct
ctatatgagctttcagagcaggagaaagacttcctctggagacacagacattattgttta
aacatcccagagtctctgcctaagctgcttctgtcagtcaaatggaactccagagacgaa
gtgtcgcagatgtactgtttactgaaggaatggccactgatggagccagagtccgctctg
gagctgctggactgtaactttcccgatccgatagtcagagagtttgcgctgcgctgtctg
gtgcagggcttgacggatgacaagttgtcacagtatctgctgcagcttgtacaggtgtta
aaatatgagatgtacttggacaatcctctggcccgattcctcatcaagaaagctctgacc
aatcagaggataggacacttcttcttctggcatctgaagtcagaaatgcacaataagacc
atttccagaaggtttggccttttgctagaggctttctgcagagcctgcggcatgtacctg
aaacacttgaacagacaggtggaggccatggataaactggtgaatctgacagacaccctg
aagcaggagaagaaggacgagactcagaagactcagatgaagttcttggttgaacacatg
tcacgtccagactacatggagtctctgcaaggatttgtctctccactaaacccagttcac
cagctgggaaacctcaggctggaggagtgcaggatcatgtcctcggcgaagcgccccctg
tggctgaactgggagaatcccgacataatgtccgagctacttttcaccaacaatgaaatc
atcttcaagaacggagacgatctgcgtcaagacatgctgacgctgcagatcattaagatc
atggagaacatctggcagaaccaaggcctggacctgcgaatgctgccgtatggctgcctg
tccatcggtgaccgtgtgggtctcattgaggtggtgaagaacagctatactatcatgcag
attcagtgcaaaggaggcctgaagggggcgctgcagttcaactccaacactcttcaccac
tggatcaaagacaagaaccacggagaagcgtatgatcgggccatcgacttgttcaccaga
tcctgtgcaggttattgcgttgccacattcatcctgggaattggagaccgacacaactcc
aacatcatggtgaaggagaacggacagctgttccacatcgacttcggccacttcctagat
cacaagaagaagaaatttggctacaaaagggagcgtgtgcctttcgtcttgactcaggac
tttctcatcgtcatcagtaaaggcattcaggagtcgacaaagacaaaggagtttgagagg
ttccaggagatgtgctacaaagcttacctggccatccggcagcacgccagcctcttcatc
aacctcttctccctcatgctgggctgcggcatgcctgaactgcagagctttgatgacatc
gcctatcttaggaagacccttgcattagaaaagagccagcaggaggcgctggagtacttc
acaaaacagatgaacgacgctcatcacggaggatggagcaccaagatggactggatcttc
cacaccatcagacacatgcccaacgaacactga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114161826
Entry
114161826         CDS       T05908                                 

Gene name
pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00562  Inositol phosphate metabolism
xco01100  Metabolic pathways
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04070  Phosphatidylinositol signaling system
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114161826 (pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114161826 (pik3cb)
   04370 VEGF signaling pathway
    114161826 (pik3cb)
   04068 FoxO signaling pathway
    114161826 (pik3cb)
   04070 Phosphatidylinositol signaling system
    114161826 (pik3cb)
   04150 mTOR signaling pathway
    114161826 (pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114161826 (pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    114161826 (pik3cb)
   04218 Cellular senescence
    114161826 (pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114161826 (pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114161826 (pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114161826 (pik3cb)
   04625 C-type lectin receptor signaling pathway
    114161826 (pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114161826 (pik3cb)
   04914 Progesterone-mediated oocyte maturation
    114161826 (pik3cb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114161826 (pik3cb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114161826 (pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114161826 (pik3cb)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     114161826 (pik3cb)
Membrane trafficking [BR:xco04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114161826 (pik3cb)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd 2_5_RNA_ligase2 DUF4135 RWD
Other DBs
NCBI-GeneID: 114161826
NCBI-ProteinID: XP_027901214
LinkDB
Position
18
AA seq 1079 aa
MPPAMTDLLDIWAAHSPLAGHAPDQITVDFLLPTGIYIQMDVPREATIQHIKLLLWKQAQ
NFPLFPSLGEMESHMFECVNQAAVHEELEDETRRLCDVRPFLPVLKLVTRNCGRAERLLD
SKIGVLIGKGLHELDGINDQEVKDFRSKMFRLSEEKMQRVQMMTCNEWLQACFSPQLEPA
ALTTITDGLNDRPADLKVIIHFDQSQDSTSLKVLSSSTPSELMEMAVKKWLITHAPEEEE
WSGQYVLRVSHCLEFLCGDHPLIQYKYIRTCLQAKEPPHLTLVHTSTIKELFDKEMSAIS
AVVSRKSSNPPLPLPPKRRIPTQAQTCVWDVTSSFRIVLVKGSKVNAEESAKVQVRAGLF
HGTELLCKPAVSSETSGRSEHTWRDNALEFDISISDLPRMTRLCFAIYAVMDKVKKQKST
KNPHINKYQTIRKAGKVHYPIAWVNTMVFDYKGQLKTGDIILHCWSSFPDELEEMLNPIG
TIQTNPYTENATALHIHFPEYSPYPIVFPPFDKILEKAAQIARASDSMSIGRGGKKFHIE
LKEIMERDPLSQLCENEKDLIWTLRHDCRENFPQSLPKLLLSVKWSKHEDMAQLQALLQI
WPKLCPRDALELLDFNYPDQYVREYAVGCLRDMSDEELSQYLLQLVQVLRYEPYYDCALT
HFLLERAERNRKIGHFLFWHLRSEIHMPAVSVQFSLILEAYCRGSIPHIEVLKKQVEALT
KLKSVNELIKLGTLKNARSKTKEAMLTKEAMITCLKQSGYSEALSDLSSPLNPSVLLSDI
SVEKCRYMDSKMKPLWIVYNNKLLNGDTLGIIFKNGDDLRQDMLTLQILRLMDLLWKEAN
LDLRIVPYGCLATGDRAGLIEVVSSADTIANIQLTNSNVAATAAFNKDALLNWLKERNSG
DALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFGI
KRERVPFILTHDFIHVIQQGKTGNTEKFGSFRQYCEDAYLILRKNGNLFITLFALMLTAG
LPELTSVKDIQYLKDSLALGKTDDEALKQFRQKFDEALRESWTTKVNWMAHNVAKDNRS
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgcctcctgccatgacagacctcctggacatatgggcggcccactcgcccctggccgga
cacgctccggatcagatcaccgtggactttctgctgcccaccggcatctacatccagatg
gatgttccccgcgaggccacaattcaacacatcaaactgctcttatggaagcaggctcag
aacttcccactgtttccctcccttggcgaaatggagagccacatgttcgaatgtgtcaac
caggcagctgtgcacgaagaactggaggatgaaacccgccgactgtgcgacgttcggccc
tttctgccagtcctgaagctggtgacgcgcaactgtggacgagctgagcgcctgctggac
tccaaaataggagtactcattggaaaaggtctccatgaactggatggcattaatgaccag
gaggtgaaggacttccgcagtaagatgtttcgtctcagtgaagagaagatgcaacgagtg
caaatgatgacgtgcaacgagtggctgcaggcctgtttctcgccgcagctggagcctgca
gcattgacaactatcacagatgggctcaatgaccggccagccgatcttaaagtcatcatc
cactttgaccagtctcaggactcaacaagtctaaaggtgttgtcgtctagtaccccctct
gagctgatggagatggctgtgaaaaagtggcttatcactcacgcgcctgaggaggaggag
tggagtggtcagtatgtgctccgagtcagccattgcctggagttcctctgtggagaccat
cctctgattcaatacaagtacattcgcacatgccttcaagctaaggagcctcctcacctc
accctggtccacaccagcaccattaaggagctgttcgacaaggaaatgtctgccatcagt
gccgtagtcagccgcaagtcctccaatccaccgttaccactacctccgaaacgaagaatt
cccacgcaagcccagacgtgtgtgtgggatgtgacgagctcgttcaggatagtcctggtg
aaaggcagcaaggtgaatgccgaagagagcgcaaaggtccaggtgagggcgggcctcttt
cacggcacagaactgctgtgcaagccggccgtgagcagtgagaccagtgggcgctcggag
cacacctggagggacaacgctctggagtttgatatctccatctctgatttaccacgcatg
acccggctatgcttcgctatctacgccgtcatggataaggtcaagaagcagaagtccacc
aagaatcctcacataaacaaataccagaccatccgaaaggcagggaaagtgcactacccc
atagcttgggtcaacacaatggtgtttgactacaaagggcagctgaagactggagacatt
atcctgcactgctggtcttcttttcctgatgaacttgaagagatgctgaacccaatagga
accattcagaccaacccatacactgagaacgccacagcgctgcacatccactttccagag
tactctccatatcctatcgtctttccccctttcgacaagatcctggaaaaagctgcacag
attgccagagccagtgactccatgtccataggtcgcggtggtaagaagttccacatagaa
ctgaaggagattatggagcgggacccgctttctcagctgtgtgaaaacgagaaggattta
atttggacactacgccacgactgccgtgaaaatttcccccagtctctaccaaagctgttg
ctctccgttaagtggagcaaacacgaggacatggcccagctccaggccctgcttcagatt
tggcctaaactttgtcccagagatgctctggagcttctggacttcaactatcctgatcag
tacgtcagagagtacgctgtgggctgcctgcgggacatgagtgatgaggaactgtctcag
tacctcctgcagttggtgcaggtgttgcgttatgagccttattatgactgcgcactcacc
cacttcttgctggaacgtgcagaaaggaaccgtaaaattggacacttcctcttctggcac
cttcggtcagagatccacatgccagccgtgtcagtccagttctccctcatcctggaggcc
tattgtagaggaagcatccctcatattgaggttttaaagaaacaggtagaagccctgact
aagctgaagtctgtcaatgagctaatcaagctgggaacccttaaaaatgctcgaagcaaa
acaaaggaagccatgttgaccaaggaggccatgataacgtgtttgaaacagagcggttac
tcggaggctctgtcagacctgagctcccctctcaaccccagtgtgttgctgtctgacatc
agtgtggagaagtgtcgctatatggactccaagatgaagcctctttggattgtttacaac
aacaagctgcttaatggagatactttgggaatcatcttcaaaaatggagacgacttgagg
caagacatgttgaccctacagatactgaggttgatggatcttctgtggaaggaagcaaat
ctggacctcaggattgttccatatggttgcttagcaacgggtgacagagcaggactcatt
gaagtggtctcatcagcagacacgatcgccaacatccagttgaccaacagcaacgttgca
gcaaccgcagcgttcaacaaggacgctttgctaaactggctgaaagaaaggaactctggt
gatgctctcgaccgggccatcgaggagttcacgttgtcctgtgcgggctactgtgtagct
acttacgtcctgggcattggagaccgccacagcgacaacatcatggtccgcagcacaggg
cagctgtttcacatagacttcggtcacatccttggcaacttcaagtccaagttcggaatc
aagagggaacgcgtaccctttattctcacacatgacttcatccacgtcattcaacagggc
aagacggggaacacggaaaaatttggcagttttcgtcaatattgcgaggacgcttatctt
atcttgaggaagaacggcaacctcttcatcacgctgtttgccctcatgctgactgctgga
ctaccagagttaacctctgtcaaagacatccaatacctaaaggactctcttgctctgggg
aagacagacgatgaggccctgaagcagttccgccaaaagtttgatgaagcgctgagagaa
agttggacgaccaaggtcaactggatggcccacaacgtggccaaagacaaccgctcctag

DBGET integrated database retrieval system