KEGG   Xiphophorus couchianus (Monterrey platyfish): 114141698Help
Entry
114141698         CDS       T05908                                 

Definition
(RefSeq) uncharacterized protein PFB0145c-like
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Spc7 TPR_MLP1_2 DUF3450 AgrB
Motif
Other DBs
NCBI-GeneID: 114141698
NCBI-ProteinID: XP_027868212
LinkDB All DBs
Position
3
AA seq 1234 aa AA seqDB search
MENNRDEDSSTVNVNNAKHPLNTEEVESSALRLSSLLLLCLGLLCVILTANIVYMSFTTT
TQQENITSLATEKQQLIKEQKIMEKKIEEVIRDRHLSQVRARLTRERLTQDREKLSNKIE
ELNKERDELSEEKEKVNKQKEELSRERNKLKYKTEKLKEEREDVSKKKEELSKAKEELSK
KKEELSKEKDKLSKDRKELSKEKEELRKNTNEPSKGNEDLRKEKEKLSKEKKELTKEKNE
LNKNKGELSKDEEKLSKDKKELSKEKDKLNKEKDDLSKDKKKVSKDKKELNKEEGDLKNL
TIELSKEENELNKKTKEWNKEKDELNKKKEQLSKNTKELNTEKEKLNKRKDELTKLKAEL
SQEKKGLTKEMNKENEELNKIKDDLSKKRAELSKTTDELSKEKAGLNKEKDELSKQKREL
SKEKDKLDKEKDELNKYKDKLSKEKKELSKKNDELNKYKDKLSKEKKELSKENDELSNKR
NDLNKEKDELNKKKVDQSKTKAELNRKTEELNKEENNLNKKKLELNKENEELKKKKVDLS
KEKTKLVKEKEELNKKKVDLSKETAGLDKEKQEFSKKKVDLNKVKTDLNKKKEELNKETV
NLSKKTEQLSKETKELNEQKADLNTMKTDLNKMKQELNKEKVELNEEKGNLSVLRKESEI
RCKEREALKTFYDYVMKFKNFPVEEFCPLNMRPKCEDCRVKEPSYNGHCYWIQDDLLSSM
TWDLGRKWCNLYGSDLVVIDDLEEQEFITLQIKYHEAGKGFWLGLHHTPGGWVWIDGRKN
TLEMENNSDDSDSATVNVNNAKHPLTSEEEEEPSALRRSSLLLLCLGLLCVILTANIVYM
SMMTANQLENIKTLTTDKKRLIEERKMMENQIEEVIRDRHLSVVRAGLTRERLTQEREEL
NKEREELRKKIDDLSLEKEELSKKNDDLNNEKDELNKEKDELSKKTAELSSKTEELSKEK
AELSKNTKDLNKEKLELNKEKDKLSEDKKEQSQEKDKLNKEKDELSKDKKELSQEKEKLN
KERADLSKEKKYLSTEKEELKKDKAELNKEREKLRVLTDEAENRCKNRDALKKFFNHVMR
FRTFPVSEMCPLYMRTKCPACREKEPLYKGHCYWIYPYDIGLLTWYQGDIWCFDDGGSLV
VIDDLEEQEFINNHTTRYKGDHGYWIGLRNVRNKWLWVDERRNTLDFWIKGIPHTSGAAL
HMSERKATESWRAEDIQRDNKIICERPMIVWPYN
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaacagggatgaagactcttctacagtcaatgtcaacaatgccaaacatcct
cttaatactgaagaagtggaatcatcagcactccggctctcttctctgttgttgctgtgt
ttggggttgctttgtgtcatactgactgcaaacatcgtctacatgagtttcacgacgacc
actcagcaggaaaatatcacaagccttgcaacagaaaaacagcaactgattaaggaacaa
aaaattatggagaaaaagattgaggaggtgatccgagacagacacttgagccaagtaaga
gcgaggcttacccgagagaggcttactcaagacagagagaagctgagcaataagatagag
gagcttaacaaagagagagacgagctgagcgaagagaaagagaaggtgaacaaacagaaa
gaggagctgagccgagaaagaaacaagctgaagtataagacagagaagctgaaagaagag
agagaggatgtgagcaaaaagaaagaggaactgagcaaagcgaaagaggagctgagcaaa
aagaaagaagagctgagcaaagagaaagataagctgagcaaagatagaaaggagttgagt
aaagagaaagaggagctgagaaaaaatacaaacgagccaagcaaagggaatgaggatctc
agaaaagagaaagagaaactgagcaaagagaaaaaggagctgacaaaagagaaaaatgag
ctgaataaaaacaaaggtgagctgagcaaagatgaagaaaaactaagcaaagacaaaaaa
gaactgagcaaagagaaagacaaactaaacaaagaaaaagacgatttaagcaaagacaaa
aagaaggtgagcaaagataaaaaggaactgaacaaagaggagggcgacctgaagaattta
acaatagagctgagcaaagaggaaaatgagctgaacaaaaagacaaaggagtggaacaaa
gagaaggatgagctgaacaaaaagaaagaacagctaagtaaaaacacaaaggagctgaac
acagaaaaagaaaagctgaacaaaaggaaagatgagttgacaaaattgaaagcagaactg
agccaagagaaaaaggggctgacaaaggaaatgaacaaagagaatgaggagctgaacaaa
atcaaagatgatctaagcaaaaagagagcagagctgagcaaaacaacagatgagctgagc
aaggagaaagcagggctgaacaaagagaaagacgagttgagcaaacagaaaagggagctg
agcaaagagaaagacaaactggacaaagagaaagatgaactgaacaaatacaaagacaag
ctgagcaaagaaaaaaaggagctgagcaaaaaaaatgatgaactgaacaaatacaaagac
aagctgagcaaagaaaaaaaggagctgagcaaagaaaatgatgaactgagtaataagaga
aatgatctgaacaaagagaaagatgaactgaacaaaaagaaagtcgaccagagcaaaacg
aaagcagagctgaacaggaagacagaggagttgaacaaagaggaaaataatttgaataaa
aagaaattggagctgaacaaagagaacgaagagctgaaaaaaaagaaagtggatctgagc
aaagagaaaacaaagctggtcaaagagaaagaagaactgaacaaaaagaaagtagatctg
agcaaagagacagcgggactggacaaagaaaaacaggagtttagtaaaaagaaagtggat
ctgaacaaagtgaaaacggatctaaacaaaaagaaagaggagctaaacaaagagacagtg
aatctgagcaaaaagacagagcagctgagcaaagagacaaaggagctgaacgaacagaaa
gcggatctgaacacaatgaaaacggatctgaacaaaatgaaacaggagctgaacaaagag
aaagtggagctgaatgaagagaaaggaaatctgagcgtattgagaaaggagtcagagatt
cgatgcaaagagagagaggccctgaagaccttctacgactatgtcatgaagtttaaaaat
tttccagttgaagaattctgccctctaaatatgagaccaaagtgtgaggattgcagggta
aaggagccatcatacaatggacactgctactggattcaggatgacttactaagttcgatg
acctgggatttaggtcgaaagtggtgcaatttatatggttcagatttggttgtaattgat
gatctggaggagcaggaatttatcacccttcaaataaaataccacgaagctgggaaagga
ttctggttagggttacatcatacgccaggcggatgggtctggattgatggacgtaagaac
acccttgagatggagaacaacagcgacgacagtgactctgctacagtcaatgtcaacaat
gccaaacatcctcttacatctgaagaagaagaggagccatcagcactccgacgctcttct
ctgttgttgctgtgtttggggttgctttgtgtcatactgactgcaaacatcgtctacatg
agtatgatgacggccaatcagctggaaaatatcaaaacccttacaacagacaaaaagcga
ctgattgaggaacgaaagatgatggaaaaccagatcgaggaggtgatccgagacagacac
ctgagcgtagtcagagcaggacttacccgagagaggcttactcaagagagagaggagctg
aacaaagagagagaagagctgaggaaaaagattgacgacctgagcttagagaaagaagag
ctgagcaaaaagaatgacgatctgaacaatgagaaagatgagctgaacaaagagaaagac
gagctgagcaaaaaaacagcagagctgagcagcaagacagaggagctgagcaaagagaaa
gcagagctgagcaaaaacacaaaggacctgaacaaagagaaactcgagcttaacaaagaa
aaagacaagctgagcgaagacaaaaaggagcagagccaagaaaaagacaaactgaacaaa
gagaaagacgagctgagcaaagacaaaaaggagctgagccaggagaaagagaaactgaac
aaagagagagcagatctgagcaaagagaaaaagtatctgagcacagagaaagaggagctg
aagaaagataaagcagagctgaacaaagagagagagaagctgagagtattgacagacgag
gcagagaaccgatgcaaaaacagagatgctctgaaaaagttcttcaatcacgtcatgaga
tttaggacatttccagtttcagagatgtgccctctatatatgagaacaaaatgtccggct
tgcagggaaaaggagccattatacaagggacactgctactggatttatccatatgacatt
ggtttgctaacctggtaccaaggtgacatctggtgttttgatgatggtggaagtttggtt
gtaattgatgatctggaggagcaggagtttatcaacaatcacaccacaagatacaaaggt
gaccatggatactggatagggttacgtaatgttcgaaacaaatggttgtgggttgatgaa
cgtaggaacactcttgatttctggataaaagggattccccatacttcaggagcagcactt
catatgtcagaaagaaaagccacagagagctggagagcagaagacatacagagagataac
aaaatcatctgtgagcgtccgatgattgtttggccctataactaa

DBGET integrated database retrieval system