KEGG   Xiphophorus couchianus (Monterrey platyfish): 114142345
Entry
114142345         CDS       T05908                                 

Gene name
megf8
Definition
(RefSeq) multiple epidermal growth factor-like domains protein 8 isoform X1
  KO
K23664  multipile epidermal growth factor-like domains protein 8
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114142345 (megf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:xco04990]
    114142345 (megf8)
Domain-containing proteins not elsewhere classified [BR:xco04990]
 Laminin domain-containing proteins
  Laminin EGF-like domain-containing proteins
   114142345 (megf8)
SSDB
Motif
Pfam: Kelch_3 Kelch_4 Kelch_5 Kelch_6 Kelch_1 CUB Kelch_2 Laminin_EGF PSI EGF_3 EGF_CA EGF
Other DBs
NCBI-GeneID: 114142345
NCBI-ProteinID: XP_027869381
LinkDB
Position
3
AA seq 2889 aa
MQPKRRELAVPEMASPLPVSVVILVVLLSAESPVCQAGDCKGHRQVLRGLPGFVTDGPGN
YSVNGNCEWLIKAPSNGHRIVLNFTFMDTECTYDYLFVYDGDSYQSPLLASLSGNSLPEP
IEAKSGKMLIHLFSDANYNLLGFNATYTFSVCPGACGGHGRCDSSTSKCHCHQSWGGASC
TAPLCSQACSLNGQCDKKGERCQCNPGFLGHSCQLGLRDDKGPGQWWRVSEGNPNAPPRT
GSAGAYLSSTGAMYLFGGFDLNRALGDLIKYNFTSNQWESRSYGHSPVARHSHTAVQYMG
NMVVFGGELANGSLASDVWMYRPVQDDWQQLGFSHSRGAPKLANHAAAVVDTYLYIFGGR
TEEDMFSSTLYRFGLHGSGRWETVQPTGGKPPASAGHSMVFHSPSRTLLVYGGHRPTTAR
FSVRVNNTDVFHVDRRFWTSFRSRFPTTGPRERAFHTATVIGNYMVVYGGNVHIHYQEEK
CYDEEIFFYHLGCHQWVSSGERWSSNGEAVRGRYSHVAAVMEGRVLLVAGGYSGVARGDL
VAYKVPLFVSSDQGDRDAVCAEALDESMCLKNPECSWCEGRCREYQPTNPCGSTGCLGLA
RFLSDCQSCLVFSGTPASLARAPGEFGWCVQNESCLPVSERSACRVDQISGAYGWWGERT
RFLTSLHSCRTENYVPGLHLLTFQHPRNDSQPDKVSILRSTNIILSPTTEMDVALQFKGF
IHPLWGGPPPAPPPTETVFIWARIQRLHFEARVASGPNSTQMEVVGRWAAQQEKELKLLV
RPDGGRLFSNLTRGNHYLVQAEGYLNNSGSGQTSEMALIWNRTLPGGSEISFLFLEPYRS
GSCLGYMSCLACLSDQSCGWCPSLSRCLLRDGPDPEYCPETEMVEGKGDGQRHLLLAPQH
CTLCEDYRDCSACTQDPYCEWQINSSKKGDFQCSRRGRLEGSIRDSNGCPKVCNQRNTCS
ECLSNSSQCAWCESAQACFYFAAYLTKYPYGECRDWYDSVHSVPQCKQCSALNTCTECLK
TFQCGWCGDYNNPTIGKCLRGDWAGMDDPSVYNCSVAVAEARAANPEPQTSAPPRPLEME
MEMEILDDEEKDAVWSYPTCPDVEECRLGLHNCHPFATCINTPTSYECHCERGYTGDGTL
HCNQTCYNECREGQCSGSPRFECECSLGWTSDPATLVLSGVECDVDCGCNFHSTCITAPG
ICDECQDWTTGPHCEHCRPGSFGSALAGSGGCVPCECNGHGDPLQGYCHNLTGQCYCTHN
TQGPHCESCLPGYYGDPRNNGTCYRQCQGRSVLLSSTSSSTIPLSSSLGWRSGTEGKGGL
SHCLWVLSVTEKLGPCKPKQLCPPVALTLHPDSHTYCKNSYVYVFDGLPRFLPNGVVRSD
HNLIGAFCGTTRTQPITVEATSGVISVYFEANVSSNKPQGFNASFWVRRCQQSSDEDEEG
SAVCAGGAQCQGGLCQCPQGYGGPYCDRPMCPQDCGATEERGVCNISLGVCVCSESWAGS
DCSVLRDPNSLIWETLLDTQLTMKQAHRFLHRMGHSLVAGPQGNLWMYGGLSLSDGILGN
VYRYSLLEHRWTQMLTSSVDESATPGARYHHAAALLNTYDLDSGSHEGGHSLMLVVGGVT
QSGVAMDTWTLNLSSLVWREHKSSVLPPVAGHTLTVRWESSVLLIGGYSPENGFNHHLLE
FNPDSGNWTIVPHTGTPPTGLYGHSAVYHEQTDAIYVFGGYRFHVETVEPSGELYSLYYP
NLTWSLLVPSQGKKPLSRFFHAAALIKDTMVIVGGRTEAEDYSNSVSLYQINCNTWIHPV
SAVGDPVNRSVSLAMTTWGGRLFLSGGFNGVTLGRLLTLTVPSDPCALLPTPEACNTTTG
SCVWCRGTCTSSDAAERIGCLLGHSTCSPTPRQPDQCRRLKTCSECLARHPKTFSSPPQS
ALQCKWCTNCPEGACISSSVSCTSEHDCRINQREIFLSSNCTETSCEASDCPKCTASGKC
MWTRQFKRTGETRRILSVNPTYDWTCFSYALLNVSPMQVESSPPLPCPPPCHTLHNCSLC
LGSRGSDGGWQHCVWSMALQQCMSPSFVPLRCEAGQCGRLLSGGDSCSPKCSQLTQCSQC
IARPQCGWCASGGGNGAGRCLQGGVDGVSEGVCPVRNSTWSFLHCPEEDECANGHHHCNS
TQDCHDLPEGYHCTCKQGYILNGVSGQCEPVCAQGCVNGTCVSPGICQCHFGFVGDNCSS
ECKCNKHSNCTSVDKPDVCLECHNNTQGIHCEKCKPLFVGSAVDGGSCRPCRDFCRGNGM
VCLSRDEYNKAIENPHHFPVDAIEKWVSEGPTENTAVCVNCQNNSVGDKCEGCRRGYFLL
NGKCEKCQCNGHADTCEPDGSGCPCQNNTETSSCLSSPQNDRKDCYRQQCAKCKDSFNGN
PVNGRQCYRQFNVDSEFCFDPTSQTNCFHDPTIRNLPKDRTVFFAAQPKFTNVDIRVTID
VTFGEVEVYVSNSHDTFIVDVDRYTGIHTIKIEDESASRGTAAGADKDSPPSPIKVFANA
SSNLGGPVLSHNPLQLQAKPPGAEREIREERAEGLISYITVWKPQTVLIVRGVRDRVVIT
FPHEVHSLKSSRFYIALRGVGTDDRQGESQGLLFVRQDQAHIDLFVFFSVFFSCFFLFLS
VCVLLWKVKQFLDFRREQRRHIQEMTKMASRPFAKLTIYLEPEEPQLIYLPTAGGGVGGS
TVSIAHARTGKLSAVVVGQRGRAGPVYKHDPGSGPTAHHHHHHHHHLTLSGGGNSGQHLP
LHYLNTHHYASTTAGTQSSHHHHPSTYSGYQQFCRSDPFLSQLMGFSYSSFKVGPITLEP
TEDGMAGVATVLFQLPGGVLAPNRACLGSALVTLRQNLQEYCGHGSGGGHPGAGAGRKGL
HQHLTTMAM
NT seq 8670 nt   +upstreamnt  +downstreamnt
atgcaaccaaagagacgggaattggcagtgccagagatggcctcccctctccctgtctcc
gttgtcattctggtggtcctcctgtcagctgagtcacctgtgtgccaggcaggggactgc
aagggccacaggcaggtgctgaggggccttcccggttttgtgactgatggacccggaaac
tactctgttaatgggaactgcgagtggcttatcaaagctcccagcaatggtcatcgaatt
gtgttaaatttcacctttatggacacagaatgtacctacgactatctgtttgtgtatgat
ggcgactcctaccaaagtccacttcttgccagtctgagtggaaactctttgcctgaaccc
attgaggccaagtctggcaagatgcttattcacctcttcagtgatgctaattacaacctc
ttgggcttcaatgcaacatacaccttctctgtttgtcctggagcctgtggcggccatggg
cgctgtgattcctctacatccaagtgccactgtcaccagagttggggcggagcatcatgt
acagctcctctgtgttcccaggcttgttctttgaatggacaatgtgacaagaaaggagag
cgttgtcagtgtaaccctggcttccttggccacagctgtcagcttggtctccgtgacgat
aaggggccgggacaatggtggcgtgtgagtgagggaaaccctaacgcacctccgaggaca
ggctctgctggcgcgtacctgtcctctactggagccatgtatttgtttggaggatttgat
ctgaacagagctcttggtgacttgatcaagtacaatttcacttccaaccaatgggaaagc
agatcttatggtcattcccctgtggctcgtcactcccacactgctgtacagtacatgggt
aatatggttgtctttggaggagagctagctaacggatccctggccagtgacgtttggatg
taccggcctgtccaggatgattggcaacagctcggtttctcccactcacgcggtgctccc
aaactggccaatcatgctgcagcggtcgtcgatacctatctctacatttttggaggtcgc
actgaggaggacatgttttcctcgactctgtatcgcttcggtttgcacggttctggacga
tgggaaacggttcagcccaccggtgggaaaccccctgcctctgctggccactctatggtg
ttccacagcccatccaggactttgttggtctacggaggccacaggcctactactgcaagg
ttcagcgtgcgggtcaacaacaccgacgttttccacgtggacaggcggttttggacatcc
ttccgttcccgttttccaaccactgggcccagagagcgagctttccacactgccactgtc
attggaaactacatggtggtctatggtggaaatgtgcatattcattaccaggaagagaaa
tgttatgatgaggaaatctttttctatcatttgggctgccaccagtgggtgtcttctggg
gagagatggtcatccaatggtgaagctgtgagggggcggtattcacatgttgcagcggtg
atggaaggacgtgtgctgctggttgctggtggttacagcggtgttgcccggggagatctt
gtggcttataaagtaccgctgtttgttagcagtgatcaaggcgacagggatgctgtttgt
gccgaggcgcttgatgaaagtatgtgcctgaagaacccagagtgcagctggtgtgaaggc
cgctgtcgagagtaccagcccaccaatccgtgtggcagcactgggtgcttgggcctggct
cgcttcctgtccgactgccagtcctgcctggtgttcagcggcacgccggcgtctcttgcg
cgagcccccggagaatttggctggtgtgttcagaacgagtcctgcctgccagtgtcagag
cgaagtgcgtgccgtgtggaccagatctcaggggcgtacggctggtggggggagcgtacc
cgtttcctaacctccctccactcctgtcgcaccgagaactatgtcccgggactgcacctg
ctcaccttccagcacccccgcaacgactcccagcctgacaaggtatccatcctccgcagc
accaacatcattcttagccccaccacagaaatggatgtggccctacagttcaagggcttc
atccaccccctgtggggagggcctccacctgcacctcctcccacagagaccgtcttcata
tgggctcgcatccagaggctccactttgaggctcgagtggcatcaggacccaactccacc
caaatggaggtggtgggtcgctgggcagcccagcaggagaaggagctgaagctgctggtc
cgaccagatggaggtagactcttctccaacctgaccagggggaaccattacctcgttcaa
gccgaaggctaccttaacaactctggctctggacagacgagtgagatggccctgatctgg
aacagaacattgcctggagggagtgagatttccttcctgttcctggagccgtaccgttct
ggttcctgcttgggttacatgtcctgcctggcctgcctgtctgaccagtcgtgtggctgg
tgtccgtctctgtcccgctgcctgttgcgagacggcccagacccggaatactgtcctgag
acagaaatggttgaaggcaaaggagacggtcagcgccatctgctgttggcaccacagcac
tgcaccctgtgtgaggattacagagattgctctgcatgtactcaggacccttactgtgag
tggcagattaactccagcaagaaaggcgactttcagtgcagccgcagaggaaggttggag
ggatccatccgtgactcaaacgggtgtcctaaagtctgcaaccagagaaatacatgcagt
gaatgtctgtccaactccagtcagtgtgcatggtgtgaatctgcccaagcttgcttctac
tttgctgcctacctcacaaaatatccctacggagagtgcagggactggtatgacagtgtc
cattcggttcctcagtgtaagcagtgttcagctttaaacacgtgcacagagtgcctgaaa
acatttcagtgtggctggtgtggtgactacaacaatcccacaattggaaagtgtttgagg
ggagactgggcaggaatggatgatccatctgtgtataactgcagtgtggctgtggctgaa
gctcgagctgcaaaccctgaacctcaaacttcagccccacccagacccctggaaatggaa
atggagatggagatcttagatgatgaggagaaagatgcggtctggtcttaccccacatgt
cctgatgtggaggaatgcaggctgggcctccacaactgtcatccctttgccacgtgtatc
aacactcccacctcgtacgagtgtcactgtgagagaggatacaccggcgatggcacgctg
cactgcaaccagacctgttataatgaatgccgtgagggccagtgtagcggcagcccacgg
tttgagtgtgaatgttctctgggctggacgtccgaccccgccacgctggttctgagtggc
gttgaatgcgatgtagactgtggctgcaacttccactccacctgtatcactgcccctggg
atctgtgatgaatgccaggactggactacaggcccccactgtgaacactgccgtccgggg
agcttcggctccgccctggctggaagtggcggctgcgttccttgtgagtgtaatggacat
ggcgacccgctccagggttactgtcacaacctgacaggccagtgctactgcacccacaac
actcaggggccacactgcgagtcttgccttcctggttactatggagaccctaggaacaac
ggcacatgttaccgtcagtgccagggccgctccgtcctgctgtcctccacctcttcctca
accatccccttgtcttcgtctttgggatggcggagtggcacagaagggaaaggaggactt
tctcactgtctttgggtcttatctgtcactgagaagcttggaccttgcaagcccaaacag
ctctgccccccagtagcgctcacgttacacccagactcccacacttactgtaaaaattct
tacgtttacgtgtttgatggcctccctcgttttctgcccaatggagtcgtgcgttctgat
cacaacctcattggagcgttttgcggaacaacaaggactcagccaatcacagtcgaggcc
acctcaggtgtgatctcagtctactttgaagccaacgtctcttcaaacaaacctcaaggc
ttcaacgcgtctttctgggtgcgacgttgtcagcagagctctgatgaggacgaagagggg
tccgctgtgtgtgcaggtggagcccagtgtcagggtgggctctgccagtgtcctcaagga
tatggggggccatactgtgaccgacccatgtgcccccaggattgtggagcaacagaagaa
agaggagtttgtaatatatctctgggagtttgtgtgtgttctgaaagctgggccggctct
gactgctcagttctgcgggaccccaacagcttgatttgggagactctgttggacacacaa
ctgaccatgaaacaggcccataggttcctgcacaggatgggacattctttggtagctgga
cctcagggcaacctgtggatgtacggggggctttctctgtcagacggcattcttggaaat
gtgtacagatattctttgttggagcaccgttggacccagatgttgaccagttctgtagat
gaatcggcgactccaggcgctcgctatcatcatgctgctgcgctgctgaacacttatgat
ctggactctggaagccacgagggcggtcacagcctaatgttagtggtcggcggtgtcact
caaagtggtgttgccatggatacctggactctcaatctcagcagcttggtctggagagaa
cacaagagctcagtgctgcccccggtggccggtcacactttaactgtacgttgggaatcc
tcggttctcctgatcggaggctactctcctgaaaacggtttcaaccatcatctgttggag
ttcaaccctgattcagggaactggacaattgtcccccacaccggaacgccacctacaggt
ttatatggccactcagctgtgtatcatgagcagactgatgccatctacgtgtttggaggc
tatcgctttcacgtggagacagtggagccgtcaggcgagctctacagcctgtattacccc
aacctgacctggtctctcctggttccctcacaggggaaaaagcccctgtcccgttttttc
cacgctgctgctctgatcaaagacaccatggtgattgtaggtgggaggacagaagcagaa
gactacagtaactctgtgtctctgtaccagatcaactgcaacacctggatacatcctgtt
tcagctgttggagacccagtcaatcgctctgtgtctctcgcgatgacaacctggggcggt
cgtcttttcctgtccggtggctttaatggtgtcacactgggtagactcttaactctgact
gtgccctctgacccctgtgccctcctgcccacaccagaggcctgcaacaccaccacaggc
agctgtgtgtggtgcaggggtacctgcacttcttctgatgctgccgagagaattggctgc
ctgttgggacattccacctgctccccgactcctcgtcagccagatcagtgccgcagactt
aagacctgtagcgaatgtcttgctcggcatcccaagacgttttccagtccgcctcagtct
gctttacagtgcaagtggtgcacaaactgtccagaaggggcttgcatcagtagctctgtc
agctgtacatcggaacatgactgtcgcatcaaccagagagagattttcctgtccagcaac
tgcactgagaccagctgcgaggcttcagactgccccaagtgtacggcttctggaaaatgc
atgtggactcgccagttcaaacgcacaggcgaaacaagacgaatcctgagtgtgaacccc
acttacgactggacgtgtttcagctatgcgctgctcaacgtctcccccatgcaggtggag
tcgtcgccacctctcccatgccctcctccatgtcacactctgcataactgcagcctgtgt
ctgggctctaggggctctgatgggggctggcagcactgtgtgtggagtatggctctgcag
cagtgcatgagtccatcttttgtgcctcttcgttgtgaagcgggccagtgtggccggctt
ctctctgggggagactcctgctctccaaagtgctcccagctcacccagtgctcccagtgc
atcgccaggcctcagtgtggctggtgtgcctctgggggaggcaatggagctgggcgctgc
ttacagggaggagttgatggtgtgagtgagggcgtttgccccgtgagaaacagcacttgg
tctttcctgcattgtccagaggaggatgagtgtgccaacggtcatcaccattgcaacagc
actcaggactgccacgacttacctgagggctaccactgcacatgcaagcagggttacata
cttaatggtgtttctggtcagtgtgagccggtgtgcgcacagggctgcgttaacgggacc
tgcgtgtccccgggcatttgccagtgccactttggctttgttggagataactgttcttct
gagtgcaaatgcaacaagcacagcaactgcaccagtgttgacaaacccgatgtttgtctg
gagtgtcataataacacccaaggtattcactgcgagaaatgcaagcctctgtttgtaggc
tctgcagtagatggcggcagctgtcgtccatgtcgggacttttgccggggaaacggcatg
gtatgtctgtcccgggatgaatataataaggccattgagaaccctcatcacttccctgta
gacgccattgagaaatgggtgtctgaaggtcccacagaaaatactgcggtgtgtgtgaat
tgccaaaacaacagtgttggggacaagtgtgagggctgccgtcgtggctacttcttactg
aatgggaagtgtgaaaaatgtcagtgtaatggccatgccgacacatgtgagcccgatggt
agcggttgcccatgccaaaacaacacagagacctcgtcctgcctgagcagccctcagaat
gatcgaaaagactgttacaggcaacaatgtgccaaatgcaaagactccttcaacgggaac
ccagtgaacgggcgccagtgctaccgtcagtttaacgtggactcagagttctgctttgac
cccacgtcccaaacaaactgcttccatgaccccaccattcgcaacctgcccaaggatcgc
accgtgttctttgctgctcagccaaagtttacaaatgtggacatccgggtcaccattgat
gttacatttggagaagtggaggtttatgtctccaactcgcacgacacctttatagtggac
gtggaccgttacacggggattcacactattaagatagaggacgaatcagcaagtcgaggg
acagctgcaggggcagataaggattctcctccgtcccctataaaagtgttcgccaacgcc
tcgtccaacctgggaggtcccgtgctctcccacaatcccctgcagctgcaagccaaaccc
ccgggagcagagagagagatcagagaggagcgagccgagggactcatctcctacatcacc
gtgtggaagcctcagacggtgctgatcgtccgaggagttcgggaccgcgtggtcatcacc
ttcccccatgaggtgcactccctgaaatccagccgcttttacatcgctctcagaggtgtg
ggaacggatgatagacagggcgagtcccaggggctgctgtttgtgcgacaggaccaggcc
cacatagacctcttcgtcttcttctccgtcttcttctcctgcttttttctctttctgtct
gtgtgcgtcctgctgtggaaggtcaagcagttcctggacttccgtcgggagcagcgtcgc
cacattcaggagatgaccaaaatggcttccagacccttcgctaaactcaccatttacctt
gaaccggaggagcctcagctcatctacttacctacagctggtggcggggtggggggcagc
accgtatcgatcgctcacgcccgcacgggcaagttaagcgccgtggtggtgggtcagaga
ggcagagcgggaccggtctataaacacgacccaggctccggacccacagcacaccaccac
caccaccaccaccatcacctcaccttgagtgggggaggcaacagcggacagcatctacca
ctgcactacttaaacacccatcattacgccagcaccaccgcaggcacccagtcctcccat
catcaccatccatccacgtactctggctaccagcagttctgccgctctgaccctttcctc
tcgcagctcatgggcttctcctactcctccttcaaggtggggcccataaccctagagccc
acagaggacggcatggccggggtagccaccgtccttttccagctgcctggcggtgtcttg
gcaccaaatcgtgcctgtttgggctctgcactggttaccctgcgccagaatctgcaggaa
tactgcggccacggcagtggaggcggccacccaggggcgggcgcgggccgcaagggtctg
catcagcacctgaccaccatggcaatgtag

DBGET integrated database retrieval system