KEGG   Xiphophorus couchianus (Monterrey platyfish): 114142834
Entry
114142834         CDS       T05908                                 

Gene name
csnk1g1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114142834 (csnk1g1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114142834 (csnk1g1)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114142834 (csnk1g1)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114142834 (csnk1g1)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 114142834
NCBI-ProteinID: XP_027870136
LinkDB
Position
4
AA seq 471 aa
MDQQREKYGERTTRSTKANQGNRSGHRPSGSSNTSGVLMVGPNFRVGKKIGCGNFGELKL
GKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKSLGTTAEGVPQVFYFGPCGKYNAMVMEL
LGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKE
HIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM
FMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFE
KPDYEYLRTLFTELFERKGYTFDYTYDWVGRQIPTAVGSVHIDSGASAVTRESHPHRDRP
SQHAPVRNQTAGSDRRGAWEVQPTRQANSSYLTSHLAADRHGGSVQVVSSTNGELNADDP
LAQSNTPITPQADVEVVDEPNTQVINNWMFLLEKDKDDNRKLQEDDSGPVF
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggatcaacaaagagagaagtatggcgagcggacgactagaagcaccaaagctaaccag
ggaaaccggagcggacaccgaccgtccggctcctcgaacacctccggcgttctcatggtg
ggacctaattttcgcgtggggaagaagatcggttgtggaaactttggggaactgaagctc
ggtaaaaatctctacacaaatgagtatgtagccattaaactggaaccagtgaagtcgagg
gccccacagctacatttggagtaccggttctacaaaagtctcgggaccacagcagaggga
gtaccgcaggtgttctacttcggcccctgtgggaagtacaacgccatggttatggagctg
ctagggccgagtctagaggatctctttgacctttgcgacaggaccttttcactgaagact
gtcttgatgattgcaattcagctgatttctcgaatggagtatgtgcactctaaaaatctc
atctacagagatgtcaagcctgaaaactttctcatcggaaggcaagggaataaaaaggag
cacatcatccacatcattgactttggcctagccaaagagtacatcgaccccgagaccaaa
aaacacattccataccgggagcataagagcctgactggtactgccagatacatgtccatt
aacacacacttaggcaaagagcaaagcagacgagatgacctggaggctttagggcacatg
ttcatgtattttctgcgtgggagtttaccttggcaaggactaaaggctgacacattgaaa
gaaagataccagaagattggtgatacaaaacgaaacactcctattgaagtcctctgtgag
aattttccagaggaaatggccacctatttgcggtatgtaaggcggttagacttcttcgaa
aagcctgactacgaatatctgaggactctatttactgagctgtttgagagaaaaggatac
acgtttgactatacttacgactgggttgggaggcagatacccacggcggtgggatctgtc
catatagactctggtgcctctgcggtaacaagagagagccatcctcacagagaccggccc
tcgcagcacgcgccggttcgaaatcagacggcaggctcagaccgacgaggagcatgggag
gtgcagcccacgcggcaagcaaactcttcctatttgacctcccacctggcagcggacagg
cacgggggctcagtacaggtggtcagctcaaccaacggcgagctgaacgcagacgaccct
ctggctcaatccaacaccccgattacacctcaggcagatgtggaagtggtcgacgagccc
aacacacaagtgatcaacaactggatgtttctactggaaaaagacaaagacgacaacagg
aagttgcaggaggatgatagtggcccggtcttttaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114146655
Entry
114146655         CDS       T05908                                 

Definition
(RefSeq) casein kinase I-like isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114146655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114146655
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114146655
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114146655
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr CK1gamma_C Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 114146655
NCBI-ProteinID: XP_027876744
LinkDB
Position
6
AA seq 421 aa
MDFDKRGVGGGGGGGKGEAEDGKRMSGKAGGRSGHSGRVAGSGSGVLMVGPNFRVGKKIG
CGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSSEGVPQVFYFGPCGK
YNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLV
GRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRD
DLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRDTPIEVLCENFPEEMATYLRY
VRRLDFFEKPDYDYLRKLFTDLFDRNGYIFDYQYDWTGKPLPTPIGPVATEAPLQTSNRE
KAPQTKNQVMNSTNGELNTDDPTAGHSNAPITANAEVEVPDDIKCCCFFKRRKRKALQRH
K
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggactttgacaagcgtggagttggtggaggaggaggtggagggaagggggaggctgag
gatgggaagaggatgtctgggaaggcagggggaagatcgggacacagcggccgagttgct
ggctccggctcaggagttctgatggttgggccaaacttccgggtcggaaagaagatcggg
tgtgggaactttggagaactacgacttggaaagaacttgtacaccaatgaatatgtggcc
atcaaactggaacccatcaagtcccgagcgccacaattacatctagaatatcgcttttac
aaacaactgggaagttcagagggcgtacctcaggtgttttactttggaccatgtgggaaa
tataacgccatggttctggagctgcttggacccagtctagaagacctgtttgacctctgc
gacagaactttctctctaaaaactgtactcatgatagccatacagctgataacccgaatg
gagtttgtccacaccagaagcctcatctatcgagacgtgaagcctgagaacttcctggtg
ggccgacccggctccaaacggcaacacaccattcacatcatagactttggcctcgcaaaa
gaatacatagaccctgagacaaagaaacatatcccatacagagaacacaagagtttgact
ggaactgccagatacatgagcatcaatacacatttggggaaagagcaaagcagaagggat
gaccttgaagcgttaggccacatgttcatgtactttctgcggggcagcctgccatggcaa
ggactaaaggccgacactctgaaggaacgctatcagaaaataggagacacgaagcgagac
acgccgatagaggtgctctgtgagaatttcccagaagagatggccacatacctgcgatat
gtgcggcggctggactttttcgagaagccagactacgactatctgaggaaactcttcaca
gacctcttcgacaggaacggatacatcttcgattatcagtatgactggaccggaaagcca
ctgccgactcctattggtcctgtggcgactgaagctccacttcagacaagcaaccgggaa
aaagcacctcaaaccaaaaaccaggtgatgaactcgaccaatggagagctgaatacagac
gatcctactgcgggacattctaacgcaccaatcacagccaacgcagaggttgaagtccct
gatgatataaagtgctgctgtttctttaagaggaggaagaggaaagctctacagagacac
aagtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114147957
Entry
114147957         CDS       T05908                                 

Gene name
csnk1d
Definition
(RefSeq) casein kinase I
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
xco04540  Gap junction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114147957 (csnk1d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114147957 (csnk1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114147957 (csnk1d)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xco03036]
    114147957 (csnk1d)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114147957 (csnk1d)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114147957 (csnk1d)
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114147957 (csnk1d)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 114147957
NCBI-ProteinID: XP_027878585
LinkDB
Position
7
AA seq 405 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDISVGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGANRA
VEDAERERREREERLRHSRNPGARGMASASGRARAAQDAAAPSPLNPASHTGMEKERKVS
MRLHRGAPVNISSSDLTGRQDTSRMSTSQALSRVTPSGLQSAAPR
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggagttgagagtcggaaaccgatacagactgggcagaaagattggaagcggatcgttt
ggagacatatacttgggtactgatatctcagtgggagaagaggtggccatcaagctggaa
tgtgtgaagactaaacacccccaactccacatcgaaagcaagatctacaagatgatgcaa
ggcggagtggggattccaactataaagtggtgtggtgctgagggagactacaatgtgatg
gtgatggagctgctgggccccagtctggaggacctgttcaacttctgctctcggaagttc
agtctgaagaccgtcctcctgcttgctgaccagatgatcagcaggattgaatacatccac
tccaagaacttcatccaccgagacgtgaagccagacaacttcttgatggggctgggcaag
aagggcaacctggtctacatcatcgactttggtctggctaagaaataccgcgacgcgcgc
acgcaccagcacatcccctaccgcgaaaacaagaacctgaccggcactgcccgctacgcc
tccataaacacacaccttggcattgaacaatccagacgggatgacttggaatctctgggc
tacgtcctgatgtacttcaacctgggctctcttccctggcaaggactcaaagctgccacc
aagaggcagaagtacgaacgcatcagtgagaagaagatgtccacccccattgaggtcctg
tgtaaaggctatccctctgagtttgccacatacttgaacttttgccgttctctgcgcttt
gacgacaagcccgactactcctacctccgccagctcttcaggaacctcttccacagacag
ggcttctcctacgactacgtctttgattggaacatgctcaaatttggtgccaacagggcc
gtagaggacgctgagagggagcgccgggagcgcgaggagaggctgaggcacagcaggaac
cccggggccagaggcatggcttcagcttcaggcagagccagggcagctcaggacgccgca
gccccctccccactcaaccctgcttcacacacaggtatggagaaggagaggaaggtgagc
atgcgtcttcatcgtggagcacctgtcaacatctcctcatcagacctgaccggccgacag
gacacgtctcgcatgtccacctcacaggctctgtcccgggttacaccaagcggcctccag
tctgcagctccgcggtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114150815
Entry
114150815         CDS       T05908                                 

Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114150815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114150815
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114150815
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114150815
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 114150815
NCBI-ProteinID: XP_027883322
LinkDB
Position
9
AA seq 447 aa
MDFDKRGGKGEAEEGKKMSKSTANRTGGRGTGTNSGVLMVGPNFRVGKKIGCGNFGELRL
GKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNSEGIPQVYYFGPCGKYNAMVLELL
GPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKRQH
TIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMF
MYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFEK
PDYDYLRKLFTDLFDRNSYVFDYEYDWVGKSLPTPIGPIPSDTPLPPSSRDKAQQQTKNQ
SPEPKGSESQPTPVTNKETLGSHLTAERLGGSVQVMSSTNGELNTDDPTAGHSNAPITAP
TEVDVVDETKCCCFFKRRKRKALQRHK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggattttgataagagagggggcaaaggagaggcagaggaaggcaaaaagatgtctaag
tcgacggccaacaggactggcggcaggggtacagggaccaattctggagttctaatggtt
ggcccgaactttcgtgtgggcaaaaaaatcggctgcggtaactttggagagctgaggtta
ggcaaaaacctctacactaatgaatatgtggccatcaaattggaacccataaagtccagg
gcgccacagctccatttggagtacagattttacaaacagttgggaaattcagagggaatt
cctcaggtgtactactttggcccatgcgggaaatacaacgccatggttctggagctgctc
gggcccagtttagaggatttgtttgacctgtgcgaccgcaccttctccctcaagaccgtc
ctcatgatagccatacagctgataacgcggatggagtacgtgcacaccaagagtctgatc
tacagagatgtgaagcccgagaacttcctcgtcgggaggcccggtagcaagaggcagcac
accatccacatcatcgactttggtctggccaaagagtatatagaccccgagaccaaaaaa
cacatcccctaccgggagcacaagagtctgacagggacagcacgctacatgagcatcaac
acacacctgggaaaagagcaaagcagaagagatgatttagaggctctgggccacatgttt
atgtacttcctccgaggtagccttccttggcagggcctgaaggctgacactttgaaggag
cgataccagaagatcggagacaccaaacgagcaaccccgatcgaagtgctttgtgagagc
ttccctgaagagatggccacctacctgcgctacgtgaggaggctggacttctttgagaag
ccagattacgattacctacggaagctcttcaccgatctgttcgacaggaacagctacgtc
ttcgactacgagtacgactgggtcggcaaatctcttcccacaccgatcggccctatcccc
agtgacacaccgctgccccccagcagcagagacaaagcacaacagcagaccaaaaaccag
tcacctgagcccaaaggaagtgagtctcagcccacccccgtgaccaataaggagactctg
gggtcgcacctcacagctgagcggctggggggctctgttcaggtgatgagctcaacgaat
ggcgagctgaacacggacgacccgacagccggacactccaacgctcccatcactgctccc
actgaggttgacgtggttgacgaaaccaagtgctgttgtttcttcaaaaggagaaagagg
aaagctctccagaggcacaagtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114152643
Entry
114152643         CDS       T05908                                 

Gene name
csnk1a1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114152643 (csnk1a1)
   04340 Hedgehog signaling pathway
    114152643 (csnk1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114152643 (csnk1a1)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114152643 (csnk1a1)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114152643 (csnk1a1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 114152643
NCBI-ProteinID: XP_027886377
LinkDB
Position
11
AA seq 365 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLDSSVGKRKRSLAVSSSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQGASSGGQGQQAQTPTGKQTDKSKP
NLKGF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggccagcagcagtggttccaaagccgagttcatagtcggtggaaagtacaagctcgtc
agaaaaattggatcgggatctttcggcgacatttatttggcaatcaacatcacaaatgga
gaggaggtagctgtaaaactagaatcccaaaaagccagacatccacagctcctatacgaa
agcaagctgtacaagatccttcaaggtggagtcgggattccacacatcaggtggtatggc
caggagaaagactacaacgtcctagtcatggacttgcttggacccagtttggaggaccta
tttaacttctgctctcgacgatttaccatgaaaactgtcctcatgctggcagaccaaatg
atcagcagaattgagtatgtacacacaaagaacttcatccatagagacatcaaaccggac
aactttctcatgggtattggccgtcactgtaacaagtgtttagactcgtcagtggggaag
aggaaaagaagcttggctgttagctcttctcaggacccatctttctcaggattaaaccag
ttattccttattgactttggtttggcaaagaagtacagagacaatcgaacacgacaacac
atcccctacagagaagacaagaacctgacagggactgcacgctatgcctccatcaacgca
catctgggcattgaacagagtcgccgtgatgacatggagtctctaggctacgtgctgatg
tactttaacagaaccagtctgccttggcaaggattaaaggcagccacaaagaagcaaaag
tatgagaagatctcggaaaagaaaatgtctactcctgttgaggttctctgcaagggtttt
ccagcagagtttgccatgtatctgaactactgccgtgggttgcgctttgaagaggcacca
gactacatgtatctgcgccaactgtttcgcattctcttcaggactctgaatcaccagtat
gactacacatttgactggaccatgctgaaacagaaagcagcacaacaaggggcctcttca
gggggccagggccagcaggcacaaacccccacaggcaagcaaactgacaaatccaagcct
aacttgaaagggttctaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114159847
Entry
114159847         CDS       T05908                                 

Gene name
csnk1e
Definition
(RefSeq) casein kinase I
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04068  FoxO signaling pathway
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114159847 (csnk1e)
   04340 Hedgehog signaling pathway
    114159847 (csnk1e)
   04068 FoxO signaling pathway
    114159847 (csnk1e)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114159847 (csnk1e)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xco03036]
    114159847 (csnk1e)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114159847 (csnk1e)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114159847 (csnk1e)
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114159847 (csnk1e)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 114159847
NCBI-ProteinID: XP_027897857
LinkDB
Position
16
AA seq 417 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRS
TEDGDRDRRAGDDRDDRIGGAPRGSASRGLPSGPTPVAPNRVRNGPEQAISNPASRVQQS
GNTSPRAISRAERERKVSMRLHRGAPANVSSSDLTARQDQSRISTSQVSVPFEHIGK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggagctgagagtggggaacaaataccggctggggcgaaagatagggagtggatccttc
ggagacatttacctcggtgccaacattgcgacgggcgaggaagtcgccatcaagctggaa
tgtgtgaagaccaaacacccacagttgcacattgaaagcaagttctacaagatgatgcag
ggaggagtcgggatcccatcgataaaatggtgtggcgccgagggcgactacaacgtcatg
gtgatggagctgctggggcccagcctggaggacctttttaacttctgctccaggaagttc
agcctgaagactgtcctgcttctggcagaccagatgatcagtcgcatcgagtacatccac
tccaagaacttcatccacagagacgtgaagccagataatttcctcatgggtttgggcaag
aagggcaacctggtgtacatcatcgactttgggctggccaaaaagtatcgtgacgcgcgc
acgcaccagcacatcccttacagggagaacaagaacctgacggggacggcgcgctacgcc
tccatcaacacgcatcttggaatcgagcagtcgagacgtgacgacctggagtccctcggt
tacgtcctcatgtacttcaacctgggctcgctgccctggcagggcctcaaggctgccacc
aagagacagaagtacgagcgaatcagcgagaagaaaatgtccacacccatcgaagttctt
tgcaaaggatatccttccgagttctccacgtacctgaatttttgccgctcgctccgtttc
gatgacaaaccggactactcctacctacgccaactgttcaggaatctcttccaccgccag
ggattctcctacgattacgtctttgactggaacatgctcaaatttggcgccagtcgatca
actgaggatggggatcgtgacagaagggccggggacgatcgagacgaccggattggagga
gcccccagggggtctgcgtcgcggggcctcccttcgggccccaccccagtcgctcccaac
agagtccggaatggaccagagcaagccatctcaaacccggcctcacgggtccagcaatct
ggcaacacgtcacctcgtgcaatttcccgcgctgagcgggagaggaaggtgagcatgcgt
ttacaccgtggcgctcctgccaacgtatcgtcctctgacctcacggcccgacaagaccag
tccaggatttccacgtcacaggtcagcgtgccattcgagcacattgggaagtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114161839
Entry
114161839         CDS       T05908                                 

Definition
(RefSeq) casein kinase I-like
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04068  FoxO signaling pathway
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114161839
   04340 Hedgehog signaling pathway
    114161839
   04068 FoxO signaling pathway
    114161839
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114161839
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xco03036]
    114161839
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114161839
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114161839
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114161839
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 114161839
NCBI-ProteinID: XP_027901240
LinkDB
Position
2
AA seq 439 aa
MVLTETERPQSREVKRSGAMELRVGNKYRLGRKIGSGSFGDIYLGSNIATGEEVAIKLEC
VKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFS
LKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDART
HQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATK
RQKYERISEKKMSTPIELLCKGYPSEFSTYLNLCRSLRFDDKPDYSYLRQLFRNLFHRQG
FSYDYVFDWNMLKFGSSRTAEDGERERREGKEGEDRAGAGQRGAGGRALPPGPNPCAANR
VRNEPETAPSNQASRGAQPSGNRSPQAGRAERAERERKVAMRLHRGAPANVSSSDLTARL
DQSRITASQVSVPFEHLAK
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggtcctgactgagacggagcgaccacagagccgagaggtgaagcgctccggagcgatg
gagctccgcgttgggaacaaatatcgcctcgggaggaagatcggcagcgggtcctttgga
gacatttacctgggctcaaacatcgccacaggagaggaagtggccatcaagctggaatgt
gtgaagaccaaacatccgcagctccacattgagagcaagttctacaaaatgatgcaggga
ggagtgggaattccctccatcaagtggtgcggcgccgagggagactacaacgtcatggtg
atggagctgctgggccccagcttggaggatttgtttaacttctgctcccgcaaattcagc
ctgaagacggtcctgctgctggccgatcagatgatcagccggatcgaatacatccactcc
aagaacttcatccacagagacgtgaaacccgacaacttcctgatgggcctcgggaagaag
ggcaacctggtctacatcatcgacttcggcctggccaagaagtaccgggacgctcgaacg
caccagcacattccctaccgcgagaacaagaacctgaccgggacggcgcgatacgcctcc
atcaacacccacctgggcatcgagcagtcaagacgagacgacctggagtctctgggttac
gtcctcatgtacttcaacctgggttcgctgccctggcaaggactcaaggctgcgaccaag
aggcagaagtacgaacgcatcagtgaaaagaaaatgtccacccctatcgagttgctctgc
aaaggatacccctccgagttctctacctacctgaacttgtgtcgctctctgcggttcgat
gacaaacccgactactcgtacctgaggcagctgttcaggaaccttttccacaggcaggga
ttctcttacgactacgtcttcgactggaacatgctgaagtttggttccagcaggacagca
gaggacggggagcgagagaggagagaagggaaggaaggagaggaccgagccggcgcgggt
cagagaggagccggaggccgagccctgcctccaggtccgaacccttgtgccgccaaccga
gtccggaacgagccagagacggctccttccaaccaggcgtcgcgtggagcccagccgtca
ggaaaccggtcgcctcaggcgggccgggccgagagagctgagagagaaaggaaggtggcg
atgaggctccaccgcggcgcccccgccaacgtctcgtcctctgacctcactgcacgcctc
gaccaatcacgcatcactgcctcacaggtcagtgtcccgtttgaacatctggcaaagtga

DBGET integrated database retrieval system