KEGG   Xiphophorus couchianus (Monterrey platyfish): 114142888Help
Entry
114142888         CDS       T05908                                 

Gene name
sord
Definition
(RefSeq) sorbitol dehydrogenase isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00040  Pentose and glucuronate interconversions
xco00051  Fructose and mannose metabolism
xco01100  Metabolic pathways
Module
xco_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    114142888 (sord)
   00051 Fructose and mannose metabolism
    114142888 (sord)
Enzymes [BR:xco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     114142888 (sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 114142888
NCBI-ProteinID: XP_027870244
LinkDB All DBs
Position
4
AA seq 354 aa AA seqDB search
MAEENLSAVLYAKGDLRIENRPISEPGPNEVLLQMHSVGICGSDVHYWQHGQIGDFVLKK
PMVLGHEAAGRVVKVGSAVSHLKPGDRVAIEPGVPRDMDEFFKRGQYNLSPTIFFCATPP
DHGNLCRYYTHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGSTVLICGAGPI
GLVSLIVAKAMGASKVIITDLFAERLGVAKELGADFQLTVKKDDGAQQLAKKVEEILGAQ
PQITIECTGVESCIQTALYATCSGGVVMLVGLGAAMTTVPLVNAAVREVDIRGVFRYCNT
WPMAIAMLSSGKVNVKPLVTHRFPLEQAVQAFETTHQGLGIKVMLKCDKNDQNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaaaacttgtccgcggtgttgtatgctaagggagacctcaggattgaaaac
cgtccgatttccgagccaggacctaatgaggtgttgctccagatgcactcagtgggaatc
tgtggatcggacgtgcactactggcagcatggccagattggggactttgtgctgaaaaaa
ccaatggtgctgggccacgaagctgcagggcgagtggtgaaggtgggatcagcagtctca
caccttaaaccaggtgacagggtggccattgagcctggtgtgccccgcgacatggatgag
ttcttcaaaagaggacagtataacttgtcccccaccatcttcttctgtgccacgccgcct
gaccatggaaacctgtgcagatattacacacacaacgccaacttctgctacaagttgcct
gataacgtcacatttgaggagggggcgctcatcgaacctctctctgtggggattcatgcc
tgtcgccgggccggcgtcaccctcggcagcaccgtactcatctgtggtgcaggacccatt
ggattggttagcttgattgtagccaaggcaatgggggcctctaaagtcatcatcactgat
ctgtttgcagagcgcctgggcgtggccaaggagctaggtgcagacttccagctgacagtg
aagaaggacgacggagcgcagcagctggcaaagaaagtcgaggaaatcctgggagcccag
cctcaaattaccattgaatgcactggagtggagagctgcatccaaactgccctttatgca
acatgttcaggcggtgtggtgatgctggtgggccttggtgctgcaatgactaccgttccc
ctggtcaatgctgctgtgagagaagtggacatcagaggagtcttccgctactgcaacact
tggccgatggctatcgccatgttgtcatcaggcaaagtgaatgtgaagccccttgtgacc
caccgctttccactggagcaggcagtgcaggccttcgagaccacacatcagggtcttggg
ataaaggtcatgttaaagtgtgacaaaaacgaccagaacccttga

DBGET integrated database retrieval system