KEGG   Xiphophorus couchianus (Monterrey platyfish): 114143123
Entry
114143123         CDS       T05908                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04068  FoxO signaling pathway
xco04110  Cell cycle
xco04115  p53 signaling pathway
xco04218  Cellular senescence
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
xco04371  Apelin signaling pathway
xco04510  Focal adhesion
xco04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114143123 (ccnd1)
   04340 Hedgehog signaling pathway
    114143123 (ccnd1)
   04371 Apelin signaling pathway
    114143123 (ccnd1)
   04068 FoxO signaling pathway
    114143123 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114143123 (ccnd1)
   04115 p53 signaling pathway
    114143123 (ccnd1)
   04218 Cellular senescence
    114143123 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114143123 (ccnd1)
   04530 Tight junction
    114143123 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 114143123
NCBI-ProteinID: XP_027870710
LinkDB
Position
4
AA seq 292 aa
MEEQLLCCEVDSIRRAHQDENLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIIPKMRKIL
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVLPGELLQMELLVLSKLKWDLASVTPHDFIEHFLSKLKIHPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDASLSSPNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHGGAAETKRMDEDADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggagcagctgctgtgctgcgaggtggactctatcaggagagcccaccaggacgag
aacctacttaatgaccgagtcctacagactatgctgaaggcagaggagaactacttaccg
tcccccaactacttcaagtgtgttcagaaagagattatacccaaaatgaggaaaatacta
gccacttggatgttggaggtctgcgaagagcagaagtgcgaggaggaggtttttccgctg
gcgatgaactatttggacagatttttatcagtggaggccaccaggaaaacaagactgcag
ctgctaggagcaacctgcatgtttctagcatccaagatgaaggagactgtccccctcact
gcagagaagctctgcatctacacggacaactcggtcctacccggggagctgctgcaaatg
gagctgctggttctcagcaagctcaagtgggatctggcttcagtcactcctcatgacttc
attgagcacttcctgtccaagttgaagattcacccctccacaaagcagatcctcaggaaa
cacgctcagaccttcgtggcgctctgcgcaacagatgtcaactttattgctagtcctcca
tcaatggtggcagcaggaagtgtggtggctgctgttcaaggtctctacctgaaaagccaa
gacgcctccctctcctcaccaaacctcaccaacttcctgtcacaggtcattcgcagtgac
ccggactgtctgcggtcgtgtcaggagcagatagagtcgctattggagtccagtctgcgg
caggctcagcaacacggtggcgcagcagaaaccaaacgcatggacgaggacgccgacctg
tcctgcacgcccacagacgtgagagacgtcaacatctga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114152343
Entry
114152343         CDS       T05908                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like isoform X1
  KO
K10151  G1/S-specific cyclin-D2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04068  FoxO signaling pathway
xco04110  Cell cycle
xco04115  p53 signaling pathway
xco04218  Cellular senescence
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
xco04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114152343
   04340 Hedgehog signaling pathway
    114152343
   04068 FoxO signaling pathway
    114152343
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114152343
   04115 p53 signaling pathway
    114152343
   04218 Cellular senescence
    114152343
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114152343
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C Vel1p
Other DBs
NCBI-GeneID: 114152343
NCBI-ProteinID: XP_027886011
LinkDB
Position
2
AA seq 293 aa
MELLCLEMDTSIRARPDPNLLRDDRVLQRLLTIEERFLPQYSYFKGVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAMEPIKKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIVRRLPLANDKLVLIRKH
VQTFIALCATDFRFAMYPPSMIATGSVGAAICGLQLDSADQSQWGDSLTDLLAKITNTEV
DVLKECQEQIERVLESSLREGRQQQQTQRGPSGKGLEELDQASTPTDVRDVNL
NT seq 882 nt   +upstreamnt  +downstreamnt
atggaactgctctgcctcgaaatggacaccagcatacgagcccgtccggacccgaacctc
ctgcgcgatgacagagttctgcagagactgctgaccatcgaggagagattcctgccgcag
tattcttatttcaaaggcgtccagaaagacattcagcccttcatgaggaggatggtcgct
acttggatgttggaggtctgcgaggagcagaagtgcgaggaagaagtttttcctctggcc
atgaactacctggacagatttttagcgatggagccgatcaagaaatgcaacctgcagctg
ctgggcgcagtctgcatgttcctggcctccaagctgaaggagacgcggccattaacggca
gagaagctctgcatctacacagataactccatcaggccgcaggagctgctggaatgggag
ctggtggttttggggaagttgaagtggaacttggcggcggtgacgccgaacgatttcatc
gagcacatcgtgcggaggctgccgctggccaacgacaagctggttctgatccggaaacac
gtccagaccttcatcgccctctgcgccacagatttccgattcgccatgtatcccccctcc
atgatcgccacaggaagtgtgggggcggccatctgcggcctgcagctggactcagccgac
caatcccagtggggcgacagcctgacggacctactggccaagatcaccaacacagaggtg
gacgttctgaaggagtgccaggagcagatcgagcgcgtcctggagagcagcctgcgtgag
ggccggcagcagcagcagacgcagcggggccccagcgggaagggcctggaggagctggac
caggcctccacgcccacagacgtccgtgacgtcaacttgtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114160373
Entry
114160373         CDS       T05908                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04068  FoxO signaling pathway
xco04110  Cell cycle
xco04115  p53 signaling pathway
xco04218  Cellular senescence
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
xco04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114160373
   04340 Hedgehog signaling pathway
    114160373
   04068 FoxO signaling pathway
    114160373
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114160373
   04115 p53 signaling pathway
    114160373
   04218 Cellular senescence
    114160373
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114160373
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 114160373
NCBI-ProteinID: XP_027898750
LinkDB
Position
16
AA seq 353 aa
MGALFLSVPGNELENEGRAATPASQDPLHSSFGSPPSPTLSILFPQQMDQALPVSLWCEE
SEENQGEPQGQSSTGGSPQLRARWDPSVSGHRVIQRLLRLEERYMPSMLYVTLIQRDPQR
REEIAKWALEVCCDCGCDEAVFPLSVSLMDRYLSAYLSLPVSPFCLAAGCILIASKLTEC
ETVTADALCSAAEFSFQPSDLREMERVILAALRWDSAAVTPQDFLPHFLSSIEERGESEL
LSTLRRHSDTLAALCVCDSRFLGAPPSLIAAASLNCALRGLGSKESPHLAAMSETLAELC
QTDPAVLQCYSEMIEFALRQRLRSGLQPGPTEKDEEVENERPGTPTDMREIDF
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgggagctctgttcctctctgtcccgggaaatgagctggaaaatgaggggcgggccgcc
acgcctgcttctcaggacccactgcactcctcttttggctctccgccgtctcccaccctc
tccatcctgtttccccagcagatggaccaagcgcttcctgtgtctctttggtgtgaggag
tcagaggagaatcagggtgaacctcaaggccagagcagcaccgggggctcgcctcagctc
cgagcccgctgggacccctccgtgtcggggcatcgagtgatccagaggctgctccgcctg
gaggagcgctacatgccctccatgctctacgtcacgctcatccagcgggatccacagcgc
cgggaggagatcgccaagtgggccctggaggtgtgctgtgactgtggatgtgacgaggcc
gtcttcccgctgtctgtctccctgatggacaggtacctgtctgcctacctgtccctgcct
gtctcaccgttctgcctggctgcaggatgcatcctgatcgcctcaaagctcacagagtgt
gaaaccgtcactgctgacgccctctgctcagcggccgagttcagcttccagccttcagac
ctgagggagatggagcgcgtcatcctcgcagccctgcgctgggactcggcagcagtgact
cctcaggacttcctgccacattttctctcctccatagaggaacgaggagagtctgagctg
ctttccacgctgaggcggcacagcgacaccctggccgccctctgcgtctgtgactcccgt
tttctgggagcccctccctcacttattgctgcagcttccctgaactgtgcactgcgaggt
ctgggcagcaaggagtcgcctcatctggccgccatgagcgagacgcttgccgagctgtgt
cagacggatccggcagtgttgcagtgctacagtgagatgatcgagtttgccctcaggcag
cggctgcggagcggactgcagcccggtcccactgagaaggacgaggaggtggagaacgaa
aggcccgggacgccgactgacatgagagagattgatttctaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114160881
Entry
114160881         CDS       T05908                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04068  FoxO signaling pathway
xco04110  Cell cycle
xco04115  p53 signaling pathway
xco04218  Cellular senescence
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
xco04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114160881
   04340 Hedgehog signaling pathway
    114160881
   04068 FoxO signaling pathway
    114160881
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114160881
   04115 p53 signaling pathway
    114160881
   04218 Cellular senescence
    114160881
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114160881
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 114160881
NCBI-ProteinID: XP_027899583
LinkDB
Position
17
AA seq 294 aa
MELYCLESDTAVKAQPDPNILYDDRVLQSLLTIEDSFLPQCSYFQRVQKDIQPYMRRMVA
GWMHEVCEEENTNQDVFPLAINYLDRFLAVMPTRKNYLQLLGAVCIFLAAKLKDCRPPSA
EKLCVYTDNSITPRELLEWELVVLGKLKWNMASVIPNDFIEHIMRRLPLPKEKQAMVCKH
TLTFIALCATDDRLAMNPPSMIATGSMAAAICGLQLDHSDQRLSRDNLTDLLAKITNTEV
DCLRACQEQIERVLASSLQQGQQYGPDSAVRGGSKSREQQDQSSTPTDVRDVNL
NT seq 885 nt   +upstreamnt  +downstreamnt
atggagctgtattgcctggagtcggacacagccgtgaaagcccagcctgacccaaacatc
ctctatgatgatagagtgctgcagagtttattaactattgaggacagttttttacctcag
tgttcgtatttccagcgggtgcagaaggacattcagccttatatgaggagaatggttgca
ggctggatgcacgaggtttgtgaagaggaaaacaccaaccaagacgtctttcctttagcc
attaattatttggacagattcttagcagtgatgcctacaagaaaaaactatttgcagctc
ctgggagctgtgtgcatcttcctggccgccaagctgaaggactgcaggccgccatcagcg
gaaaagctctgcgtgtacacagacaactccattacaccccgagagctgctggagtgggaa
ctggtcgtcctggggaagttgaagtggaacatggcctcggtcatccccaatgatttcata
gagcacatcatgcgccggctgccccttcccaaagaaaagcaggcgatggtctgcaaacac
acgctgactttcatcgccctttgtgccacagacgaccgtctcgccatgaaccctccttcc
atgatcgccaccggcagcatggcggctgcgatctgcggcctccagctggaccacagcgac
cagaggcttagtcgggacaacctgactgacctgctggccaagatcaccaacactgaagtg
gactgtttgagggcgtgccaggagcaaatcgagcgtgtgctggcctccagcctgcagcag
ggccagcagtatggacccgacagcgccgtcagaggcggcagcaagtcccgggagcagcag
gatcagtcgagcacccccacggatgtgcgcgacgtcaacttatga

DBGET integrated database retrieval system