KEGG   Xiphophorus couchianus (Monterrey platyfish): 114143484Help
Entry
114143484         CDS       T05908                                 

Definition
(RefSeq) trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114143484
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xco01002]
    114143484
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114143484
Enzymes [BR:xco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     114143484
Peptidases [BR:xco01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   114143484
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114143484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 114143484
NCBI-ProteinID: XP_027871362
LinkDB All DBs
Position
4
AA seq 250 aa AA seqDB search
MALLKVLLLLGLGVSVNSDVSLQKRIIGGQNCHDTERLYHVRLESSNGTHMKRCGGSLIH
SWWILTAAHCWKSEPGWTNVAVFKVHPRTGGEQRQLIQVTPVIYTSSNQQDDIMLLGLQT
SVTDVPVARLPDCRYRLQLDDAVQLAGEAATTTGPNNQRLPPPAAIPAHLQCVNMRVAYP
SLFMQNHGHVFHVKAPNKDVCYGDAGGAAMYNDKIYGVISLGGAEACQRPVVIMDVCEYK
AWIKRKTGLK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctgaaggttctgctgctgctggggctgggtgtttcagtgaactcagatgtt
tctctgcagaagagaatcattggaggtcaaaactgccatgacacggagcgtctttatcat
gttcggctggagagcagcaatggtactcatatgaagcgctgtggaggatctctgatccac
tcttggtggattctcactgcagctcactgctggaagtcggagccaggatggactaatgta
gcagtgtttaaagttcatccacggactggtggggagcagagacagctgatccaagtaact
cctgtgatttatacaagcagcaaccagcaggatgacatcatgttgctggggcttcagaca
tcagtaacagatgtcccagttgctcgtctaccagactgcagatatcgtcttcaactagat
gatgctgttcagctggcaggagaggcagcaacgacaaccggccccaataatcagcgattg
cccccccctgctgctattccagcacatcttcagtgtgtcaacatgagagttgcttatcct
tccctcttcatgcaaaatcatgggcatgtattccatgttaaagcaccgaacaaggatgtc
tgctatggcgacgctggtggagctgcgatgtacaacgacaagatttatggtgtgatttct
cttggtggagcagaggcatgtcagagaccagttgtaattatggatgtgtgtgaatacaag
gcgtggattaaaagaaaaactggtcttaaataa

DBGET integrated database retrieval system