KEGG   Xiphophorus couchianus (Monterrey platyfish): 114143622Help
Entry
114143622         CDS       T05908                                 

Gene name
wdhd1
Definition
(RefSeq) WD repeat and HMG-box DNA-binding protein 1 isoform X1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xco03036]
    114143622 (wdhd1)
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    114143622 (wdhd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40 HMG_box eIF2A
Motif
Other DBs
NCBI-GeneID: 114143622
NCBI-ProteinID: XP_027871646
LinkDB All DBs
Position
4
AA seq 1103 aa AA seqDB search
MPCERKPMRYGHSEGHTEVCFDDTGRYIVTCGNDGDVRIWESLDDDDPKFITVGEKAYSL
ALKKGKLVTASSSNTVQIHTFPDGDPDGILTRFTTNATHVTFNRSGTRVAAGSSDFMVKV
VEVSDSSQQKTLRGHEAPVLSVTFDPKDEYLASSSCDGSVVVWSIEQQTQVISWPLLQKT
NDVSNATSLCRLAFQPAAGKFLAVPVETRVHLYERGSWDHVGSLSDELLTQPVNVAVWSP
CGRFLAAGAIGGLLTIWDVNSRLVVERQKHEKGFTVCSLAWHPSGSQIAYTDTEGCLGLL
DGLGTSGTSTSSTKAPAAKPKDYDDLFDEDDDRLMDEGLSDANSPVKKAAEDEDDDDFLI
PSTGRVRNRGAILNDENSLDTGSLKLGQDKFGDDEDDDAGSSVAPAAAQRPVYDGPVPTP
PQKAFQPGATPAHLTHRFMMWNSVGIVRGYNDEQDNAIDVEFHDTAVHHAMHLTNSLGHT
MADLSQEAVLLACPSTDDLASKLQCLHFSCWDTSKEWMVDLPQGEDVKALCLGQGWAAVA
TSALLLRLFSVGGVQREIFSLPGPVVCMAGHGEQLLVVYHRATGFDGEQALGIQLLQFGR
RKRQLMNGEPLPLSPKSYLSWAGFTAEGTACYVDSNGLVRMLNRALGNTWTPVCNTRETC
KSKSDHYWVVGAHENPQQLRCIPCKGSRYPPTLPRPAVAILPFKLPLCQTSTEKGQMEEQ
YWRSVLFHNHYSFLSSSGYEVDEAAQTQSDKEQQELLMKMFALSCKLEREFRCVELAELM
TQNVVTLAIRYASRSRRMNLAQRLSEIALEKSTQLQEDEEPEDEPEFTSDRRTSGYQQSE
PYNTRQNEEEDDEEERVEEEDGREMETEETKRRLNPFAKESGLPVRPSLTPVGRVGRSNP
FKVADSGKPASSSGQPRASNILDNMRSSRKLAPLSGSAGKPSKGPVLKPLAPRTKAKAQS
TLLQISSNKMPNKKTPEAAEPAADLQKQPDVVAPPAENTENKRPKTGFQLWLDENRKIII
ADNPDLDETDVIKEAMGRFRTMSADERLSWTERAKGQSGDAADVKKRKRAENEAVESDES
NARKKSSSLDPSSKLSAFAFSKH
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgccctgcgaaaggaagccgatgcgctacggccactcggagggacacaccgaggtctgc
ttcgatgacaccgggaggtatattgtaacctgtggaaacgacggcgatgttcggatttgg
gaaagcctggatgatgacgatccaaagttcatcaccgttggggaaaaggcttactccctc
gcactcaagaaaggcaagttggtgacggcgagctctagcaacacggtgcagatccacacg
tttcccgacggcgatccggatggcatcctgacgcggttcaccaccaacgccactcacgtc
accttcaaccgcagcggcaccagagtcgccgccgggtccagtgacttcatggtgaaggtg
gtggaggtgtcagacagcagccagcagaaaacactgcggggtcacgaagcgcccgtcctc
agtgtgacctttgaccctaaagatgaatacttggcgtcttccagctgcgacggctcggtc
gtcgtgtggagcatcgagcagcagactcaggtgatcagctggccgttgctgcagaaaacg
aacgacgtcagcaacgccacgtctctgtgccgtttggcgttccagcctgcagccgggaag
tttttagctgttccagtagaaaccagagttcacctgtacgagcggggatcctgggatcac
gtcggctcgctgtccgacgagctgctcactcagcctgtgaacgtggcggtctggtcccct
tgcggccgcttccttgcagccggcgccatcggaggtttgctgacgatctgggacgtgaac
agccgactggtagtggaacggcagaagcatgagaaaggattcacggtgtgcagcttggcc
tggcatccatccggcagccagatcgcctacacggacacagagggctgcctgggcctgctg
gacggactcggcacctccggtaccagtaccagctccaccaaggctccagctgcgaaacct
aaagactacgacgacctgtttgacgaggatgatgacaggctgatggatgaaggactaagt
gacgccaactcaccagtaaagaaggcggcggaggatgaggacgatgacgacttcctgatc
ccgtccacgggtcgagtgaggaacagaggcgccatcctgaacgatgagaactcgctggac
acaggatccctaaaactcggtcaagataagtttggggatgatgaggatgacgacgccggc
agctctgtggccccggcggcggcgcagcgccccgtctacgacggcccggtgccgactcct
ccccagaaggcctttcagcccggagccacgccagctcacctcactcaccgcttcatgatg
tggaactctgtggggatagtgcgaggctacaacgatgagcaggacaacgccatcgacgtg
gagtttcatgacaccgccgtccaccacgccatgcacctcaccaactccctgggtcacacc
atggccgacctttcccaggaggccgtgctgctggcctgtccaagcaccgacgacctcgcc
agtaagctgcagtgcctccacttctcctgctgggacaccagtaaggagtggatggtggac
ctgccgcagggcgaggacgtgaaggcgctgtgtctgggtcagggctgggcggccgtcgcc
accagtgcgctgctgctgcggctgttctccgtcggcggcgtccagagggagatcttcagc
ctgccggggccggtggtgtgcatggccggccacggggagcagctgctggtggtttaccac
cgagcgacgggtttcgacggagaacaagctctcggcattcagctgctgcagtttggtcgc
agaaagaggcagctgatgaacggcgaaccgctccccctgtcccccaagtcgtacctctcc
tgggctgggttcaccgccgaaggcacggcgtgctacgtggattcaaacgggctggtgcgg
atgctgaaccgcgcgctgggcaacacgtggacgccagtttgtaacaccagagaaacctgc
aagagcaaatcggatcactactgggtggttggggcgcacgagaacccccagcagctcagg
tgtatcccatgcaaaggctcccggtatcctcccactctgcctcggccggctgtcgccatc
ctgccgtttaagctgccgctgtgtcagaccagcacagaaaagggacaaatggaggagcag
tactggcgttccgtcctcttccataatcactacagcttcctgtcctccagcggctacgaa
gtcgacgaggctgcgcagacgcagtcggacaaggagcagcaggagcttctcatgaagatg
tttgctttgtcctgtaaactggagcgggagtttcgctgcgtggagctggcggagctgatg
acccagaacgtggtgactctggcgatccggtacgcgtcccgatccaggcggatgaacctg
gcgcagcggctcagcgagatcgcgctggagaagtcgacccagcttcaggaagacgaggaa
cccgaagatgagccggagttcaccagcgacagacgcacctcgggttatcagcagagcgaa
ccttacaacacgaggcagaatgaggaggaggatgatgaagaagagcgagtggaggaagag
gacggaagggaaatggagaccgaggaaactaaaagacgtttgaatcctttcgctaaagag
tcgggtttacctgtgaggccgtcgctgacgccagttggtcgagttggaagatcaaacccc
ttcaaggtcgctgattctggcaagccggcgtcttcgtccggacaacctcgagcgtcaaac
atcctggacaacatgaggtccagcaggaagctggcgccgctcagcgggtcggcgggaaaa
cccagcaaaggccccgtcctcaagccgctggctcccagaaccaaagccaaggctcagtca
actttgctgcagatctccagcaacaagatgcccaataagaaaactccggaggccgcggag
ccggccgcagatctgcagaaacagcctgacgttgtagcgccacctgcagaaaacacagaa
aataagaggccaaaaacgggcttccagctgtggctggatgagaaccggaaaatcataatc
gccgataatccggacctggatgagacggacgtcatcaaagaggcgatgggacgattcagg
acgatgtcagcagacgagagactgtcgtggacagaaagagcgaaaggacaaagcggagac
gctgcagacgtgaagaaaagaaagagggcagaaaacgaagcggtggagagcgacgaaagt
aacgccaggaagaagtcgtcgtccctggatccgtcctccaagctctctgcgttcgcattc
agcaaacactga

DBGET integrated database retrieval system