KEGG   Xiphophorus couchianus (Monterrey platyfish): 114143868Help
Entry
114143868         CDS       T05908                                 

Gene name
gatb
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial isoform X1
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00970  Aminoacyl-tRNA biosynthesis
xco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    114143868 (gatb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xco03029]
    114143868 (gatb)
Enzymes [BR:xco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     114143868 (gatb)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     114143868 (gatb)
Mitochondrial biogenesis [BR:xco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    114143868 (gatb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 114143868
NCBI-ProteinID: XP_027872035
LinkDB All DBs
Position
5
AA seq 546 aa AA seqDB search
MAASSIAARELLHNIKLIPYYQKSSCLFSRRISTSKLQCSSQPPEKSAPQQLVGVVGLEI
HAQISSNTKLFSGSSVQFSAPPNSSVSFFDASLPGTLPVLNRRCVEAAVMTGLVLNCTIN
KKSVFDRKHYFYADLPAGYQITQQRRPVAVDGVLTYSFLGGRKRNQVMRKNVHIKQIQLE
QDSGKSLHDDVNSQTLIDLNRAGVGLMEVVMEPDMSCGEEAAAAVRELQLILQALGTCQG
NMSEGQLRVDANVSVHRPGEPLGTRTEVKNINSIRYLARAIDFEVQRQTAVVRRGGAVLN
ETRAYDSKSGETVAMRDKEGLQDYRFMPEPNLPPLLVFEDEASLPAGVEAGEAVLLRTLR
ARLPELPSVRRDRLVQTYGLLPEHSFTLVNEDGLMEYFEAVMKGTSRDPRKVIGWVTNEL
LGLLKQQDLSVSHSPVLPAALAELLELQEAGCISSSAAKQVFQEMWRSPGKAALQIIQEL
DLGLVSDAADLHRICQKVVDSHPDKVRAVRSGNQKVLNKLMGLVQKETKGRADPVLVREI
LQEKTS
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctccagtatagcggccagggagctgcttcataacatcaaattaataccttat
tatcaaaaatcttcctgtttgtttagcagacggatcagcacatctaagcttcaatgcagc
agtcagcctccggagaaaagcgctccgcagcagctggttggagtggtgggtttggaaatc
cacgcgcagattagctccaacaccaaactgttctccggctcctcggttcagttttcagct
cctccaaactcctcggtttcgttctttgacgcgtctttgcccggaactcttcctgtcctc
aacaggcgatgcgttgaagcagcagtgatgaccggactggttctcaactgcaccataaac
aagaagtcagtcttcgacaggaaacactacttttatgccgaccttcctgctgggtaccag
atcacacagcagcgccgcccggtggcggtggacggagtgctcacctacagcttcctggga
gggaggaagaggaaccaggtgatgaggaagaatgtgcacatcaaacagattcagctggaa
caagacagcggcaagagtctgcacgatgacgtcaacagtcagacgctcatcgacctcaac
agagcaggtgtcggtctgatggaggtggtgatggagcccgacatgagctgtggagaggag
gccgctgcagctgtcagagagctgcagctcatcctgcaggcgctgggtacctgtcagggc
aacatgtcagagggccagctgagggttgacgccaacgtgtcggtgcaccggccaggcgag
ccgctgggcaccaggacggaggtgaagaacatcaacagcataagatacctggccagagct
atagatttcgaggtccagagacagacggcggtggtgcggagaggaggagccgtgctaaac
gagacccgggcgtacgactccaagtcaggggaaactgttgctatgcgggacaaagaaggt
cttcaggattacaggttcatgccggagcccaacctgccccccctgctggtgtttgaggat
gaggcgtcgctgcctgcaggcgtggaggcgggggaggcggtgctgctgcggaccctgagg
gcaaggcttcccgagctgcccagcgtcaggagagacaggctggtgcagacgtacggcctg
ctgccagagcacagcttcactctggtgaatgaggatggcttgatggagtactttgaggcg
gtgatgaaggggaccagcagggatcccaggaaggtgattggctgggtgaccaatgagctg
ctggggctcctgaagcagcaggacctgagcgtgagccacagcccagtccttcctgccgcc
ctggctgagctgctggagctgcaggaagcaggatgcatctcctcctctgctgccaaacag
gtgttccaggagatgtggaggtcaccaggcaaggcagctctgcagatcatccaggagctt
gacttggggctagttagcgacgccgccgaccttcaccgaatctgccagaaggtcgtagac
tcacatccagacaaggttcgagccgtcaggagcggaaaccagaaagttctgaataagctg
atgggtctggttcagaaagagaccaaaggcagagccgacccggttctggtcagggaaatc
ctccaagagaagacttcatga

DBGET integrated database retrieval system