KEGG   Xiphophorus couchianus (Monterrey platyfish): 114144205
Entry
114144205         CDS       T05908                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04080  Neuroactive ligand-receptor interaction
xco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114144205
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114144205
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xco04030]
    114144205
G protein-coupled receptors [BR:xco04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    114144205
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF1634 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 114144205
NCBI-ProteinID: XP_027872560
LinkDB
Position
5
AA seq 366 aa
MSSTNSSVTVCYYNETVEFFYNNSNKTIAPFWRKRDYAVVSLGLLVCFIVIFSNLLVIFA
IFKNRRFHFPIYYLLGNLAVSDLFSGLAYLHLMFHTGPWTIRLSQYQWFVRQGLIDTSLT
ASVLNLLAIAMERHQTIFNMQLHSEMSTRRVFIIIFFIWMVSIIMGLFPTMGWNCLCDLE
RCSTMAPLYSRSFLVFWALTNLITFSIMVAVYTRIFFYVRHKSRQMSEHTTPARHRETVL
GLMKTVSMILGLFVLCWTPGLVLLMLDGLYCETCLVLNYEKYFLVLAECNSFVNPIIYCF
RDKDMRKTFKELLCCLCRRGKGPSDNDFTTLEESRLRTIRKATKTNGTPLMNHVSEDHAA
ASDGFH
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgtccagcacaaattctagcgtcactgtatgctactataatgaaactgtggaatttttt
tacaataacagcaataagacgattgctccattctggcgcaaacgggactatgcggtcgtc
tctttgggactgcttgtttgcttcatagttatcttttcaaaccttttggtcatatttgcc
attttcaaaaaccgccgctttcacttccccatctactacctgctgggtaatctggctgtt
tcagacttgttttcaggccttgcctacctccacttgatgtttcacactggcccttggacc
ataaggctatctcagtaccagtggtttgttcgccaagggctaatcgacaccagcctcacg
gcctccgtcctcaatcttcttgctattgccatggagcgacaccagaccatcttcaacatg
cagctgcacagcgagatgagcacgcggcgggttttcatcatcatatttttcatctggatg
gtgtcgattattatgggcctttttcccaccatgggatggaactgtctgtgtgacctggag
aggtgctccactatggcgccgctctacagtcgcagtttcctggtgttctgggcgcttacc
aacttgattactttctccataatggtggccgtctacacccggatcttcttttatgtgagg
cacaagagcaggcagatgtctgagcacacaaccccagccagacacagagagaccgttctc
ggcttgatgaagaccgtttcaatgatcctaggcctcttcgtgctctgctggaccccgggc
ctcgttctgctgatgcttgatggtctctattgtgaaacatgtctcgtgctgaactacgag
aagtatttcctggtgctggccgagtgcaattctttcgtcaaccccatcatctactgcttc
agggacaaagacatgaggaaaaccttcaaggagctgctgtgctgcttgtgccgccggggc
aagggcccgtctgataatgactttaccaccctcgaggagtcgaggcttcgcaccatccgg
aaggcgacgaagaccaacgggacgccgctcatgaaccacgtgtcggaggatcacgccgcc
gcctcagacggcttccactga

DBGET integrated database retrieval system