KEGG   Xiphophorus couchianus (Monterrey platyfish): 114144373Help
Entry
114144373         CDS       T05908                                 

Definition
(RefSeq) neuroblast differentiation-associated protein AHNAK-like
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 114144373
NCBI-ProteinID: XP_027872916
LinkDB All DBs
Position
5
AA seq 2602 aa AA seqDB search
MATHRRGRSLSEALTLDELENGALVISSATDSSHNLKEGDEILGATINFNQLSKEEVINV
LKLMEPFDDKVKVLTRSCLSKSVDNLDQCTRNPEAMLMDSYTKLYNAKIKRFVKDDSAAG
KAASSKVNLKRDMGLPRLGVDFGLLKSTSLSADADADTEFEVRDLMDGTNLNLPPLGGNL
NGPRPRLDARNPQSHLGNYHLSRTSPDDLNGMTAAGGLKMPNLEKVLDTGFDSKGSDEFL
PDHDIEVMGPDGMSTVPKGKLSLKQAKRLKTPDLNLDNPSGLVESPKLRLSGTLTQMDLG
NVNVDTPCGSVQLPNMESPGESVGADKTIDFSVRTPKIKSGTSASDAHLSIVDWKGINLA
TDTPSASVKSKTGKYKAPKFTMPKFDLPHIQVPDLDMDISGPSGKFRKPNLNIPDLSLSG
PKTGGPNLDLGSPDLDVCAPNLRSDFKTPKLDLSGKKTDLDMPSGTIKMPECPDWDVKGP
SGKLKMPKTNLSSTLPKGPTLDLDADLKSPDWSLKTPKIKGGINAPDLDLPDIDLKAPRL
DLNTPDVNTPKGKLKMPKMKMPKFSFLGIEGPELDGNLNGPDIDVNAPDLNLKAPKADLD
LNMPDLSGKFKKPNLTMPDLGLSGPQVDGPNLDMPSGKLNMPDIEGPDWDVKGPSGKLKM
PKVDLSGTLPKGPNLDLNTDLKSPDWSLKTPKIKGGINAPDLDLPDMDLKAPKVDMNTPD
VNIGSPKGKLKMPKMKMPKFNFPGIKGPEIDGNLNCPDIDVNAPNLNLKAPKADLDLNMP
DLSGKFKKPNLTMPDLGLSGPKIDGPNLDMPSGKLKMPDIEGPDWDVKGPSGKLKMPKMD
LSGTLPKGPNLDLNADLKSPDWSLKTPKIKGGINAPDLDLPDVDLKAPKLDINTPDVNIG
SPKGKLKMPKMKMPKFNFPGIKGPELDGNLNCPDIDVNAPNLNLKAPKADLDLNMPDLSG
KFKKPNLTMPDLGLSGPKIDGPNLDMPSGKLKVPDIEGPDWDVKGPSGKLKMPKMDLSGT
LPKGPNLDLNADLKSPDWSLKTPKIKGGINAPDLDLPDMNLKAPKVDMNTPDVNIGSPKG
KLKMPKFKMPKFSFPGIKGPKLDGNLNGPDIDVNAPNLNLKAPKADLDLNMPDLSGKFKK
PNLTMPDLGLSGPKIDGPNLDMPSGKLKMPDIEGPDWDVKGPSGKLKMPKMDLSGTLPKR
PNLDINADLKSPDWSLKTPKIKGGINAPDLDLPDVDLKAPKLDINTPDVNIGSPKGKLKM
PKMKMPKFNFPGIKGPELDGKLNGPDIDVNAPNLNLKAPKADLDLNMPDLSGKFKKPNLT
MPDLGLSGPKIDGPNLDMPSGKLKMPDIEGPDWDVKGPSGKLKMPKMDLSGTLPKGPNLD
LNADLKSPDWSLKTPKIKGGINAPDLDLLDMDLKAPKLDINTPDVNIGSPKGKLKMPKMK
MPKFNFPGIKGPELDGNLNGPDIDVNAPNLNLKAPKADLDLNMPDLSGKFKKPNLTMPDL
GLSGPKIDGPNLDMPSGKLKMPDIEGPDWDVKGPSGKLKMPKMDLSGTLPKRPNLDLNAD
LKSPDWSLKTPKIKGGINAPDLDLPDVDLKAPKLDINTPDVNIGSPKGKLKMPKMKMPKF
NFPGIKGPELDGKLNGPDIDVNAPNLNLKAPKADLDLNMPDLSGKFKKPNLTMPDLGLSG
PKIDGPNLDMPSGKLKMPDIEGPDWDVKGPSGKLKMPKMDLSGTLPKGPNLDLNADLKSP
DWSLKTPKIKGGINAPDLDLLDMDLKAPKLDINTPDVNIGSPKGKLKMPKMKMPKFNFPG
IKGPELDGNLNGPDIDVNAPNLNLKAPKADLDLNMPDLSGKFKKPNLTMPDLGLSGPKID
GPNLDMPSGKLKMPDIEGPDWDVKGPSGKLKMPKMDLSGTLPKGPNLDLNADLKSPDWSL
KTPKIKGGINAPDLDLPDVDLKAPKLDINTPDVNIGSPKGKLKMPKMKMPKFNFPGIKGP
ELDGNLNGPDIDVNAPNLNLKAPKADLDLNMPDLSGKFKKPNLTMPDLGLSGPKIDGPNF
DLGSPDLDVSRPNLRGGIKMPDINMPKANFKTPKLNLSGPKANLDMPSGKLNMPEVEGPD
WDVKGPSGKLKMPKMNLSGTLPKGPNLDLNADLKSPDFSVRAPKVKGGMNGFEMPDVGFG
SPSGNRKKYNMKMPKIGFSGSKLNDSDLDIPKIKGGLDSPNLSLANKDFRTSMPDFGVPD
VDFGTSPLKLPNLKIPDVGFSSPKLEDPKLDFTSPDFNAKLPKGQNLKLNPHLNSPELNL
KAPNMKGGVNSFKLGAPNVNLQAPKLDINTPGGNVGLPGANVKKSQMKMPKGLNANLTSD
FNMPNISGNSPKISGPKLRDSDFSLPALDLAEYGINGPKLSAKQRNLRVNGNIEPSEMNI
YDPRMKGDLIGAHMGMNSSLIDIRSPHLRSPNLNIDDASINFKGASYKNRRSDMAGMSLK
RPDLDIDQDIRLNKKSTKTNVRSSYPAVDHALHQYIDFNHSDLNIDDFTGRDHVLRARGS
QPDLRAQSKHQQWVPSSGVYVDPRNSGDHSMHGLPQNDPDGSGGYFVTVFPKQALLKSKY
NTTSRLGLPTEKWTLMFQMKTT
NT seq 7809 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacatcgaagggggcggagcctctctgaggccttgaccctggacgagttggag
aacggggcgctggtcatttccagcgctaccgattcctctcacaacctgaaggaaggggat
gaaattttgggagcaacgataaattttaatcagctgtcaaaagaggaggtgataaatgtg
ctgaaactgatggagccatttgatgacaaggtcaaagttcttaccagaagctgcctgagc
aagagtgtcgacaatttggaccagtgtaccagaaatccagaggcaatgctgatggattcc
tatactaaactttacaatgccaaaataaagaggtttgtgaaagatgactctgctgctggt
aaagccgcctcatctaaggtcaacctaaagcgtgacatggggctgcctcgccttggagtt
gattttggacttctaaaatccacatcgttgagtgcagatgctgatgcagatactgagttt
gaggtcagagatctgatggatggcaccaatctgaaccttccaccacttggtggcaatttg
aatggaccaagaccaagacttgatgctagaaatccacagtctcatcttggaaactaccat
ctctctaggacatcaccagatgatttaaatggcatgactgcagctggtggtctgaaaatg
ccaaatcttgaaaaagttctggatacaggatttgactcaaaaggttcagatgagttcctt
ccagatcatgatatagaggtaatgggaccagatggaatgtcaacagttcctaaaggtaaa
ctcagtctgaagcaggccaaaagactgaaaaccccagatctaaatttagataatccatct
ggtctcgtggaatcaccaaaacttaggctgtctgggacactaactcaaatggacctagga
aatgtcaatgtggatactccatgtgggtcagtccaattgcctaatatggagtcccctggt
gaaagtgtgggtgctgataaaacaattgattttagtgttagaacccctaagataaaaagt
ggcacgtctgcatctgatgctcatttatccatagtcgactggaagggaataaatttggcc
actgatactccttctgctagtgtcaaaagtaaaactggaaagtacaaggctcctaaattt
acgatgcccaaatttgatttgccacatattcaagtcccagatttagatatggatatttca
ggtccatctgggaaatttagaaagcccaacctaaacatccctgacttgagtctttcaggt
ccaaagacagggggtccgaacttggacctgggatcacctgatctggatgtctgtgcacct
aatctccgtagtgactttaaaacccccaaactagacctcagtggcaaaaagactgactta
gacatgccctcaggtaccataaaaatgcctgaatgtcccgactgggatgttaagggtcct
tctggaaaactcaagatgcccaaaaccaacctttcaagtacattaccaaaaggaccaact
ttagacctagatgcagatctcaagtcaccagattggagtctcaaaacaccaaagatcaaa
ggtgggataaatgctcctgatctggacttgcctgacatcgaccttaaagctccaaggttg
gatttaaatacaccagatgtgaacacaccaaaaggaaagcttaaaatgcctaagatgaaa
atgcccaaatttagcttcctaggtatcgaagggcctgaacttgatggcaacctaaatggt
ccagatatagatgtaaatgcacctgatctaaaccttaaggcacctaaagctgatctagat
ttgaacatgcctgacctgtctgggaaattcaaaaagcccaacctgactatgcctgacttg
ggtctttcaggtccacaggtagatgggcccaacttagacatgccgtcaggaaagctaaac
atgcctgatattgaaggtcctgattgggatgttaaaggtccatcaggaaaactcaagatg
ccgaaagtggacctttcaggtacattaccaaaaggaccaaatttagacttaaacacagat
ctcaagtcaccagattggagtctcaaaacaccaaagatcaagggtgggataaatgctcct
gatctggacttgccagacatggaccttaaagctcccaaggtagatatgaatacaccagat
gtcaacattggatcacccaaaggaaagcttaaaatgcctaaaatgaaaatgcccaaattt
aacttccccggcatcaaaggacctgaaattgatggcaacctaaattgtccagatatagat
gtaaatgcacctaatctaaaccttaaggcacctaaagctgatctagatttgaacatgcct
gacctgtctgggaaattcaaaaagcccaacctgactatgcctgacttgggtctttcaggt
ccaaagatagatgggcccaacttagatatgccgtcaggaaagctaaaaatgcctgatatt
gaaggtcctgattgggatgttaaaggtccatcaggaaaactcaagatgccgaaaatggac
ctttcaggtacattaccaaaaggaccaaatttagacttaaacgcagatctcaagtcacca
gattggagtctcaaaacaccaaagatcaagggtgggataaatgctcctgatctggacttg
ccagatgtggaccttaaagctcccaagttagatatcaacacaccagatgtcaacattgga
tcacccaaaggaaagcttaaaatgcctaaaatgaaaatgcccaaatttaacttccccggg
atcaaaggacctgaacttgatggcaacctaaattgtccagatatagatgtaaatgcacct
aatctaaaccttaaggcacctaaagctgatctagatttgaacatgcctgacctgtctggg
aaattcaaaaagcccaacctgactatgcctgacttgggtctttcaggtccaaagatagat
gggcccaacttagatatgccgtcaggaaagctaaaagtgcctgatattgaaggtcctgat
tgggatgttaaaggtccatcaggaaaactcaagatgccgaaaatggacctttcaggtaca
ttaccaaaaggaccaaatttagacttaaacgcagatctcaagtcaccagattggagtctc
aaaacaccaaagatcaagggtgggataaatgctcctgatctggacttgccagacatgaac
cttaaagctcccaaggtagatatgaatacaccagatgtcaacattggatcacccaaagga
aaacttaaaatgcctaaatttaaaatgcccaaatttagcttccctggcatcaaaggacct
aaacttgatggcaacctaaatggtccagatatagatgtaaatgcacctaatctaaacctt
aaggcacctaaagctgatctagatttgaacatgcctgacctgtctgggaaattcaaaaag
cccaacctgactatgcctgacttgggtctttcaggtccaaagatagatgggcccaactta
gatatgccgtcaggaaagctaaaaatgcctgatattgaaggtcctgattgggatgttaaa
ggtccatcaggaaaactcaaaatgccgaaaatggacctttcaggtacattaccaaaaaga
ccaaatttagacataaacgcagatctcaagtcaccagattggagtctcaaaacaccaaag
atcaagggtgggataaatgctcctgatctggacttgccagacgtggaccttaaagctccc
aagttagatatcaacacaccagatgtcaacattggatcacccaaaggaaagcttaaaatg
cctaaaatgaaaatgcccaaatttaacttccccgggatcaaaggacctgaacttgatggc
aaactaaatggtccagatatagatgtaaatgcaccgaatctaaaccttaaggcacctaaa
gctgatctagatttgaacatgcctgacctgtctgggaaattcaaaaagcccaacctgact
atgcctgacttgggtctttcaggtccaaagatagatgggcccaacttagacatgccgtca
ggaaagctaaaaatgcctgatattgaaggtcctgattgggatgttaaaggtccatcagga
aaactcaagatgccgaaaatggacctttcaggtacattaccaaaaggaccaaatttagac
ttaaatgcagatctcaagtcaccagattggagtctcaaaacaccaaagatcaagggtggg
ataaatgctcctgatctggacttgctagacatggaccttaaagctcccaagttagatatc
aacacaccagatgtcaacattggatcacccaaaggaaagcttaaaatgcctaaaatgaaa
atgcccaaatttaacttcccaggcatcaaaggacctgaacttgatggcaacctaaatggt
ccagatatagatgtaaatgcacctaatctaaaccttaaggcacctaaagctgatctagat
ttgaacatgcctgacctgtctgggaaattcaaaaagcccaacctgactatgcctgacttg
ggtctttcaggtccaaagatagatgggcccaacttagatatgccgtcaggaaagctaaaa
atgcctgatattgaaggtcctgattgggatgttaaaggtccatcaggaaaactcaaaatg
ccgaaaatggacctttcaggtacattaccaaaaagaccaaatttagacttaaacgcagat
ctcaagtcaccagattggagtctcaaaacaccaaagatcaagggtgggataaatgctcct
gatctggacttgccagacgtggaccttaaagctcccaagttagatatcaacacaccagat
gtcaacattggatcacccaaaggaaagcttaaaatgcctaaaatgaaaatgcccaaattt
aacttccccgggatcaaaggacctgaacttgatggcaaactaaatggtccagatatagat
gtaaatgcaccgaatctaaaccttaaggcacctaaagctgatctagatttgaacatgcct
gacctgtctgggaaattcaaaaagcccaacctgactatgcctgacttgggtctttcaggt
ccaaagatagatgggcccaacttagacatgccgtcaggaaagctaaaaatgcctgatatt
gaaggtcctgattgggatgttaaaggtccatcaggaaaactcaagatgccgaaaatggac
ctttcaggtacattaccaaaaggaccaaatttagacttaaatgcagatctcaagtcacca
gattggagtctcaaaacaccaaagatcaagggtgggataaatgctcctgatctggacttg
ctagacatggaccttaaagctcccaagttagatatcaacacaccagatgtcaacattgga
tcacccaaaggaaagcttaaaatgcctaaaatgaaaatgcccaaatttaacttcccaggc
atcaaaggacctgaacttgatggcaacctaaatggtccagatatagatgtaaatgcaccg
aatctaaaccttaaggcacctaaagctgatctagatttgaacatgcctgacctgtctggg
aaattcaaaaagcccaacctgactatgcctgacttgggtctttcaggtccaaagatagat
gggcccaacttagacatgccgtcaggaaagctaaaaatgcctgatattgaaggtcctgat
tgggatgttaaaggtccatcaggaaaactcaaaatgccgaaaatggacctttcaggtaca
ttaccaaaaggaccaaatttagacttaaacgcagatctcaagtcaccagattggagtctc
aaaacaccaaagatcaagggtgggataaatgctcctgatctggacttgccagacgtggac
cttaaagctcccaagttagatatcaacacaccagatgtcaacattggatcacccaaagga
aagcttaaaatgcctaaaatgaaaatgcccaaatttaacttccccgggatcaaaggacct
gaacttgatggcaacctaaatggtccagatatagatgtaaatgcaccgaatctaaacctt
aaggcacctaaagctgatctagatttgaacatgcctgacctgtctgggaaattcaaaaag
cccaacctgactatgcctgacttgggtctttcaggtccaaagatagatgggcccaacttc
gatttgggatcacctgatctagatgtctccagacctaatctgagaggtggaataaaaatg
cccgacatcaatatgcctaaggctaactttaagacccccaaactaaatctcagtggccca
aaggccaatttagacatgccatcaggaaaactaaatatgcctgaagttgaaggtcctgat
tgggatgttaaaggtccatcaggaaaactcaagatgccgaaaatgaacctttctggtaca
ttaccaaaaggaccaaatttagacttaaatgcagatctcaagtcaccagattttagtgtc
agagccccgaaggtcaagggtgggatgaatggctttgaaatgcctgatgtagggtttggg
agcccatcaggcaatcgtaaaaagtataatatgaaaatgcccaaaattggattttcaggt
tcaaagttaaatgactctgatcttgatattccaaaaattaaaggtggacttgattctccc
aacctgagtttagcaaacaaagacttcagaacctccatgcctgattttggtgttccagat
gttgattttggtacttcaccacttaaattgccaaacttgaaaattcctgatgtgggattt
tctagtccaaagctagaggaccctaaacttgatttcacatcaccagattttaatgccaaa
ttaccaaaggggcaaaatctgaaattaaatccgcacctcaattctccagaactgaatctc
aaagcgccaaatatgaaaggtggagtcaactcctttaagcttggtgcaccaaacgtcaac
ctccaagctcccaagttggatattaacactccaggtggcaatgttggtttacctggtgca
aatgtaaaaaagtcccaaatgaagatgccaaaaggcctcaatgctaacttaacaagtgac
tttaacatgcccaatatatctggtaatagtccaaaaatatcaggaccaaaactgagagat
tctgattttagtttgccagctttagatctagctgaatatggaataaatggtccaaagctc
agtgcaaaacaacgtaatttgagagtaaatggcaacattgaaccatcagaaatgaacatc
tatgacccaagaatgaaaggagatttaattggtgcacacatgggtatgaattcttctttg
atagacatacgcagtcctcatctaagatctccaaatcttaacattgatgatgcttccata
aatttcaagggagcctcgtataagaatcgtagatcagatatggcaggtatgagtttgaaa
agaccggacttagacatagatcaagacattcgacttaataaaaagtctactaaaaccaat
gtgaggtccagctaccctgcagtggatcatgccttacaccaatacattgattttaaccat
tcagatctcaacattgatgatttcacagggagagaccatgtgcttagagctaggggttca
caaccagacctccgagcacaatctaaacatcaacaatgggtcccgtcttctggggtttat
gttgaccccagaaacagtggagatcacagtatgcatggtttacctcaaaatgaccctgac
ggttcaggaggatactttgtcactgttttccccaaacaagctcttctgaagagtaaatac
aacacaaccagtaggcttgggttgccaacagaaaaatggaccttgatgttccagatgaaa
actacctaa

DBGET integrated database retrieval system