KEGG   Xiphophorus couchianus (Monterrey platyfish): 114144649
Entry
114144649         CDS       T05908                                 

Gene name
prkaca
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04020  Calcium signaling pathway
xco04114  Oocyte meiosis
xco04140  Autophagy - animal
xco04261  Adrenergic signaling in cardiomyocytes
xco04270  Vascular smooth muscle contraction
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
xco04371  Apelin signaling pathway
xco04530  Tight junction
xco04540  Gap junction
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114144649 (prkaca)
   04310 Wnt signaling pathway
    114144649 (prkaca)
   04340 Hedgehog signaling pathway
    114144649 (prkaca)
   04371 Apelin signaling pathway
    114144649 (prkaca)
   04020 Calcium signaling pathway
    114144649 (prkaca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114144649 (prkaca)
  09143 Cell growth and death
   04114 Oocyte meiosis
    114144649 (prkaca)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    114144649 (prkaca)
   04540 Gap junction
    114144649 (prkaca)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114144649 (prkaca)
   04912 GnRH signaling pathway
    114144649 (prkaca)
   04914 Progesterone-mediated oocyte maturation
    114144649 (prkaca)
   04916 Melanogenesis
    114144649 (prkaca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114144649 (prkaca)
   04270 Vascular smooth muscle contraction
    114144649 (prkaca)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     114144649 (prkaca)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: AGC group
  PKA family
   114144649 (prkaca)
Messenger RNA biogenesis [BR:xco03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     114144649 (prkaca)
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114144649 (prkaca)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 114144649
NCBI-ProteinID: XP_027873510
LinkDB
Position
5
AA seq 351 aa
MGNAPTARKGSEMESVKEFLAKAKEDFLKKWENPSQNTASLEQFERLKTLGTGSFGRVML
VKHRETGQHYAMKILNKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYSFKDNTNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHALDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKGHKWFAT
TDWIAIYQKKVEAPFVPKFKGPGDTSNFDDYEEEEIRVSFTEKCAKEFAEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgcgcccacggccagaaagggcagcgagatggaaagcgtcaaggagttcctt
gctaaagccaaagaggacttcctcaagaaatgggagaatccttcacagaacactgctagc
ctggagcagtttgagaggttgaaaaccttgggcacgggctcgtttggccgcgttatgctg
gtgaaacacagagaaacgggacagcattacgccatgaagatcctcaacaagcagaaggtg
gtgaagcttaagcaaatagagcacactctaaacgagaagaggatcctccaggctgtcagc
tttccctttctcgtgcgcttagagtattcattcaaggacaacaccaacctttacatggtt
atggaatatgtaccaggtggagaaatgttttcccacctacgaagaattggcagattcagt
gagccgcacgctcggttctacgctgctcagatcgtgctgacctttgagtacctgcacgct
ctggacctgatctacagagacttgaaacctgaaaacctgctcatagaccaacagggctac
atacaggttacagattttggctttgccaaacgggtaaagggccggacctggacactgtgt
ggcaccccagaatatctggctccagagatcatcctcagcaagggatacaacaaggcagtg
gactggtgggcgctgggtgttctcgtctatgagatggcagcagggtatcctcctttcttt
gccgatcagccaattcaaatctatgaaaagattgtatcagggaaggttcgtttcccatct
cacttcagttcagacctgaaggacctactgaggaacctcttacaggtggatctcacaaaa
cgctttgggaacctcaaaaatggagtcaacgacatcaaaggacataagtggttcgcaaca
actgactggattgccatctaccagaaaaaggtggaagctccctttgttccaaagttcaaa
ggaccaggcgataccagcaactttgacgactatgaagaggaggagatccgtgtctccttc
accgagaaatgtgccaaggagtttgctgaattctag

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114146401
Entry
114146401         CDS       T05908                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta-like isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04020  Calcium signaling pathway
xco04114  Oocyte meiosis
xco04140  Autophagy - animal
xco04261  Adrenergic signaling in cardiomyocytes
xco04270  Vascular smooth muscle contraction
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
xco04371  Apelin signaling pathway
xco04530  Tight junction
xco04540  Gap junction
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114146401
   04310 Wnt signaling pathway
    114146401
   04340 Hedgehog signaling pathway
    114146401
   04371 Apelin signaling pathway
    114146401
   04020 Calcium signaling pathway
    114146401
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114146401
  09143 Cell growth and death
   04114 Oocyte meiosis
    114146401
  09144 Cellular community - eukaryotes
   04530 Tight junction
    114146401
   04540 Gap junction
    114146401
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114146401
   04912 GnRH signaling pathway
    114146401
   04914 Progesterone-mediated oocyte maturation
    114146401
   04916 Melanogenesis
    114146401
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114146401
   04270 Vascular smooth muscle contraction
    114146401
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     114146401
Protein kinases [BR:xco01001]
 Serine/threonine kinases: AGC group
  PKA family
   114146401
Messenger RNA biogenesis [BR:xco03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     114146401
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114146401
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 114146401
NCBI-ProteinID: XP_027876192
LinkDB
Position
6
AA seq 365 aa
MFFFFFCMFFLLFFALSIWISTVRCFLYIVKEFLAKAKEDFLRKWENPPQCSTCLEDFDR
IKTLGTGSFGRVMLVKHTDREQYFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFIVR
LEYAIKDNSNLYMIMEYISGGEMFSHLRRIGRFSEPHARFYGAQIVLTFEYLHSLDLIYR
DLKPENLLIDNHGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALG
VLIYEMAAGYPPFFADQPIQIYEKIVAGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLK
NGVNDIKGHKWFSTTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEEPIRISLTDKCAK
EFADF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgttttttttctttttttgtatgttctttttgttgttttttgcactctcaatctggata
tctacggtccgctgtttcctatacattgttaaagagtttctggctaaagccaaagaagat
ttcttacggaaatgggaaaacccaccacagtgctcaacgtgcctagaggactttgacagg
ataaagactcttggtacgggctcatttggaagagtcatgctggtcaaacacacagacaga
gaacaatactttgccatgaaaatcctggacaagcagaaggtggtgaaacttaaacaaata
gaacacacattaaacgagaagaggatattacaagctgtgagctttccttttatcgtcaga
ctcgagtacgccattaaggacaactccaatttgtacatgataatggagtacatttcagga
ggagagatgttctctcacttaagacgaattggaagattcagtgagccacacgcacgattt
tacggtgcccagatagtgctgacgtttgagtacctacattcattagacctcatctacaga
gatctaaaacctgagaatcttctcattgacaaccatggctacctccaggtgacagatttt
ggatttgccaagagagtaaaaggaagaacctggacgttgtgtggaacaccagaatacctc
gcgccagagatcattctaagcaaaggctataacaaagctgtggactggtgggccctcgga
gttctcatctatgaaatggcagctggttaccctccgttctttgcagatcagccgattcag
atctatgaaaagatagtggctggaaaggtacgattcccatcccacttcagctctgatttg
aaggacctgttaagaaacttgctgcaggtggacctgaccaaacgctatgggaacctgaag
aacggcgtcaacgacatcaaaggccacaaatggttttccacaacagactggatcgcaatc
tacgagcgaaaggtggaagctccattcataccaaagtgtagaggccctggggacacgagc
aactttgatgattacgaggaggagcctatccgcatttctttaacggacaaatgcgcaaag
gagtttgcagatttttaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114150831
Entry
114150831         CDS       T05908                                 

Gene name
prkacb
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04020  Calcium signaling pathway
xco04114  Oocyte meiosis
xco04140  Autophagy - animal
xco04261  Adrenergic signaling in cardiomyocytes
xco04270  Vascular smooth muscle contraction
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
xco04371  Apelin signaling pathway
xco04530  Tight junction
xco04540  Gap junction
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114150831 (prkacb)
   04310 Wnt signaling pathway
    114150831 (prkacb)
   04340 Hedgehog signaling pathway
    114150831 (prkacb)
   04371 Apelin signaling pathway
    114150831 (prkacb)
   04020 Calcium signaling pathway
    114150831 (prkacb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114150831 (prkacb)
  09143 Cell growth and death
   04114 Oocyte meiosis
    114150831 (prkacb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    114150831 (prkacb)
   04540 Gap junction
    114150831 (prkacb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114150831 (prkacb)
   04912 GnRH signaling pathway
    114150831 (prkacb)
   04914 Progesterone-mediated oocyte maturation
    114150831 (prkacb)
   04916 Melanogenesis
    114150831 (prkacb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114150831 (prkacb)
   04270 Vascular smooth muscle contraction
    114150831 (prkacb)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     114150831 (prkacb)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: AGC group
  PKA family
   114150831 (prkacb)
Messenger RNA biogenesis [BR:xco03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     114150831 (prkacb)
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114150831 (prkacb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 114150831
NCBI-ProteinID: XP_027883350
LinkDB
Position
9
AA seq 380 aa
MAQGKDHSFASRLINKYLKSGQENKGQESEVPLISEFTVMWDKLMKEFLAKAKEDFLRKW
ECPAQCTTTLDEFERFKTLGTGSFGRVMLVRHKGTNQFYAMKILDKQKVVKLKQIEHTLN
EKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRTGRFSEHHARFYAAQI
VLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEII
LSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLR
NLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYERKVEAPFLPKCRGPGDTSNFDDY
EEEDIRVSQTEKCAKEFADF
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcacagggaaaggatcactcctttgccagtcgcttaatcaacaaatatcttaagagt
ggacaagaaaacaagggacaggagagtgaggtgcctctgatctctgagttcaccgtcatg
tgggataagttaatgaaagagttcttagcaaaagccaaagaagattttttaagaaaatgg
gagtgtcctgcacagtgtacaacaaccctggatgagtttgaaaggttcaagactctgggc
actggctcatttggacgtgtgatgcttgtgaggcataaaggaacaaaccagttctacgcc
atgaagatcttggacaagcaaaaagtggtgaagttgaagcagatagaacacacactaaat
gagaaaagaatactgcaggccgtctccttccctttccttgtccgattggaatacgctttc
aaggacaactcaaacctctacatggtgatggaatatgtgcccggtggagaaatgttctca
cacctcagacgcacaggaaggttcagtgaacatcatgcaagattttatgcagctcagatc
gtgctcacttttgagtaccttcactccttagacctcatctacagagacctaaagcctgaa
aacctgctcatagatcaacatggatacatccaggtcacagactttggctttgccaaacgg
gtaaaaggcagaacttggacattgtgtggaactcctgagtacctggctccagagatcatc
ctcagcaagggctacaacaaagctgttgactggtgggcacttggagttcttatctatgag
atggctgctggctaccctccattttttgctgaccagccaatacagatctatgaaaagatt
gtgtctggcaaggtacgatttccctctcactttagctccgacctgaaggacctgctgagg
aacctgctccaggtagatcttacaaagagatttggcaacctgaagaacggtgtaaatgac
ataaaaaaccataagtggttctccacaacagactggatagccatctatgagcgaaaggtt
gaagctcccttcttgccgaagtgcagaggacctggagacacgagcaacttcgacgactac
gaagaggaggacattcgcgtctcacaaacagaaaagtgtgcaaaagagtttgctgacttt
tag

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114159753
Entry
114159753         CDS       T05908                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04020  Calcium signaling pathway
xco04114  Oocyte meiosis
xco04140  Autophagy - animal
xco04261  Adrenergic signaling in cardiomyocytes
xco04270  Vascular smooth muscle contraction
xco04310  Wnt signaling pathway
xco04340  Hedgehog signaling pathway
xco04371  Apelin signaling pathway
xco04530  Tight junction
xco04540  Gap junction
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114159753
   04310 Wnt signaling pathway
    114159753
   04340 Hedgehog signaling pathway
    114159753
   04371 Apelin signaling pathway
    114159753
   04020 Calcium signaling pathway
    114159753
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114159753
  09143 Cell growth and death
   04114 Oocyte meiosis
    114159753
  09144 Cellular community - eukaryotes
   04530 Tight junction
    114159753
   04540 Gap junction
    114159753
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114159753
   04912 GnRH signaling pathway
    114159753
   04914 Progesterone-mediated oocyte maturation
    114159753
   04916 Melanogenesis
    114159753
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114159753
   04270 Vascular smooth muscle contraction
    114159753
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     114159753
Protein kinases [BR:xco01001]
 Serine/threonine kinases: AGC group
  PKA family
   114159753
Messenger RNA biogenesis [BR:xco03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     114159753
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114159753
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 114159753
NCBI-ProteinID: XP_027897668
LinkDB
Position
16
AA seq 377 aa
MSVIHKLAGRLFHRGGPCLGDVSGGEGTHHRPQEELEACHSMKEFLAKAKEDFLKKWENP
AQQTAALDHFERLKTLGTGSFGRVMLVKHRETGQHFAMKILDKQKVVKLKQIEHTLNEKR
ILQAVNFPFLVRLEHSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLT
FEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSK
GYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLL
QVDLTKRFGNLRNGVNDIKGHKWFATTDWIAIYQRKVEAPFIPKCKGPGDTSNFDDYEEE
EIRVSITEKCAKEFAEF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtctgttattcacaagctggcaggaaggttgtttcaccgaggcggaccgtgtctgggg
gacgtgagcggtggagaaggcacacatcaccgaccacaggaggagctagaggcctgccac
tccatgaaggagtttcttgccaaagccaaagaagatttcctgaaaaaatgggagaatcca
gctcagcaaactgcagcgttggatcactttgagcgtttgaagaccttaggcactggctca
tttgggcgcgtcatgttggttaaacacagagagacgggacagcattttgctatgaagata
cttgacaaacaaaaggtagtgaaactgaagcagatagaacacacactgaacgagaaacgc
atcctgcaagctgtcaatttccccttcctggtgcgactggaacactcgtttaaggataac
agtaatctgtatatggtgatggagtatgtgcctgggggggaaatgttctcacatttaagg
aggattggtagatttagtgaaccacatgcccgcttctacgcagcccagattgtactgacc
tttgaataccttcactccctggatctcatctaccgagatctgaagccagagaacctcctg
attgatcagcaaggctacatacaggtaacagatttcggatttgcaaaaagagtgaaaggc
cgtacctggacgctttgtgggactccagagtatctggcgccagagatcatcctcagtaaa
ggttacaataaggcggtggactggtgggctctgggggttctgatatatgagatggctgct
ggttatcctcccttcttcgcggaccagcccattcagatttatgaaaagattgtatcgggg
aaggttcgtttcccgtcccacttcagctcagacctgaaggatctgttgagaaatttgctg
caggtggacctgaccaaacgcttcggcaacctcaggaatggagtcaatgatatcaagggt
cacaagtggtttgctaccacagattggattgccatctaccagagaaaggtggaagctcct
tttatcccaaagtgcaaaggtcctggtgatacgagcaactttgatgactacgaagaagag
gaaatccgagtttccatcacagagaagtgtgcaaaggagtttgcagagttttag

DBGET integrated database retrieval system