KEGG   Xiphophorus couchianus (Monterrey platyfish): 114144713
Entry
114144713         CDS       T05908                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2-like isoform X1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04120  Ubiquitin mediated proteolysis
xco04144  Endocytosis
xco04340  Hedgehog signaling pathway
xco04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114144713
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114144713
   04350 TGF-beta signaling pathway
    114144713
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114144713
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114144713
   04121 Ubiquitin system [BR:xco04121]
    114144713
   03029 Mitochondrial biogenesis [BR:xco03029]
    114144713
Enzymes [BR:xco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     114144713
Membrane trafficking [BR:xco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    114144713
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    114144713
Ubiquitin system [BR:xco04121]
 Ubiquitin ligases (E3)
  HECT type E3
   114144713
Mitochondrial biogenesis [BR:xco03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    114144713
SSDB
Motif
Pfam: HECT WW C2
Other DBs
NCBI-GeneID: 114144713
NCBI-ProteinID: XP_027873600
LinkDB
Position
5
AA seq 776 aa
MSNQGVRRNGPVKLRLTVLCAKNLAKKDFFRLPDPFAKVVVDGSGQCHSTDTVRNTLDPK
WNQHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLNRL
GPNDNDTVRGQIVVSLQSRDRIGSGGPVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPSGRPLSCVVDENTPVMTPVNGAVASGPPGEQRVQERRVRSQR
HRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNVNCEELG
PLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNSPSSNGSRVAPDSQNTNL
SHPPQLKDQGGPGVPPQALSPAQLPEEAECLTVPKYKRDLVQKLKILRQELSQQQPQAGH
CRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNP
YYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQL
LGKPITLDDMESVDPDLHNSLVWILDNDITGVLDHTFCVEHNAYGEIIPHELKPNGKSIP
VTEDTKKEYVRLYVNWRFLHGIEAQFLALQKGFNEVIPQHLLKSFDEKELELIVCGLGKI
DIADWKSNTRLKHCTPDSNIVKWFWKAVESFDEERRARLLQFVTGSSRVPLQGFKALQGA
AGPRLFTIHQIDANANNLPKAHTCFNRIDIPPYESYDKLYDKLLTAIEETCGFAVE
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcgaaccaaggagtaaggagaaatggcccagtaaagctgcggttgacagtcctctgt
gcaaaaaacctggcaaagaaagacttctttcggttgccggatccttttgctaaagtggta
gtggacggttctggacaatgccactcaacagatactgtgagaaatactcttgatccaaag
tggaatcaacattatgatctctacatcggaaagtcggactccattactatcagtgtctgg
aaccacaagaagatccacaaaaagcagggcgcgggattcctcggctgcgtccggctcctg
tccaatgccatcaacagactcaaagacacgggctatcagagactggacctgaataggctg
ggccccaacgataacgacaccgtaagaggacagatagtagtgagtcttcagtccagagat
cgcatcggatccgggggaccagtggtagactgcagccgcctgtttgacaacgatttgccc
gacggctgggaagagaggaggacagcatcggggaggatacagtacctgaaccacatcacc
cgcaccacgcaatgggagagacccaccaggccggcgtcggagtactccagcccatccgga
cgtccgctgagctgcgtggtagacgaaaacacgccggtgatgactcctgttaacggggcc
gtggccagcggacctccaggcgaacagcgtgtccaggagcgacgggttcgatcgcagcgg
catcggaactacatgagtcgaacacacctgcatacgccgcccgatctgcctgagggctac
gaacaaagaaccacccagcagggccaggtgtatttcctccacacacagaccggagtcagc
acctggcacgacccccgagtacccagggacttaagcaatgtgaactgtgaggagctggga
ccactgcctccaggctgggagatcaggaacaccgccaccggccgcgtctactttgttgac
cacaacaatcgaacaacacagttcacagatccacgattgtctgccaacctgcatctagtg
ctcaacagcccaagttcaaatggttcccgcgtggccccggacagccaaaacactaacctc
agtcatccaccacagctaaaggaccagggtggtcccggagtccctccgcaggctctgtct
cccgctcagctgccggaagaggcggagtgtctgacggtgcccaagtacaagagagacctg
gtgcagaagctgaagattctccggcaggagctctcgcagcagcagccgcaagccggccac
tgccgcatcgaggtcagccgggaggagatcttcgaggagtcgtatcgacaagtgatgaag
atgcgtccgaaggatctctggaaaagactgatgataaaattcagaggagaagagggactg
gactatggaggagttgctcgggaatggttgtacctgctgtcgcacgagatgttgaaccca
tattacggcttgttccagtactccagagacgacatctacactctacagattaacccagac
tctgctgtcaacccagaacacctgtcatacttccactttgtgggccgcatcatgggcatg
gcggtgtttcacggccactacatcgacggaggcttcacgttgccgttttacaaacagctg
cttgggaaaccaatcacgctggacgacatggagtctgtcgaccccgacctccacaacagc
ctcgtttggatcttggacaatgacatcacaggggtcctggaccacactttctgcgtggag
cacaacgcttacggagaaatcatcccacacgagctgaagcccaacgggaagagcatcccg
gtgacggaggacaccaagaaggagtatgtcaggctctacgtgaactggcgtttcctccat
ggcatcgaggctcagtttctggctctccagaaaggcttcaacgaggtcatcccgcagcac
ctgctcaagtccttcgacgagaaggaattagagctgatcgtgtgcggcctggggaagatc
gacatcgccgactggaagtccaacactcggctgaagcactgcaccccagacagcaacatt
gtcaagtggttctggaaagccgtggagtcgttcgacgaggagaggagggcccggctgctg
cagttcgttactggctcgtccagagtcccgctgcagggcttcaaggctttacagggtgca
gcaggacccagactcttcaccattcatcagattgatgccaacgccaataacctgcccaaa
gcgcacacctgcttcaaccggatcgacattcctccctacgagagctacgacaaactgtac
gacaagctactgacggcgatcgaggagacgtgcggcttcgcggtggagtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114159764
Entry
114159764         CDS       T05908                                 

Gene name
smurf1
Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF1 isoform X1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04120  Ubiquitin mediated proteolysis
xco04144  Endocytosis
xco04340  Hedgehog signaling pathway
xco04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114159764 (smurf1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114159764 (smurf1)
   04350 TGF-beta signaling pathway
    114159764 (smurf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114159764 (smurf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114159764 (smurf1)
   04121 Ubiquitin system [BR:xco04121]
    114159764 (smurf1)
   03029 Mitochondrial biogenesis [BR:xco03029]
    114159764 (smurf1)
Enzymes [BR:xco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     114159764 (smurf1)
Membrane trafficking [BR:xco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    114159764 (smurf1)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    114159764 (smurf1)
Ubiquitin system [BR:xco04121]
 Ubiquitin ligases (E3)
  HECT type E3
   114159764 (smurf1)
Mitochondrial biogenesis [BR:xco03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    114159764 (smurf1)
SSDB
Motif
Pfam: HECT WW C2 Laminin_G_2
Other DBs
NCBI-GeneID: 114159764
NCBI-ProteinID: XP_027897703
LinkDB
Position
16
AA seq 732 aa
MSNPGSRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKVVVDGSGQCHSTDTVKSTLDP
KWNQHYDLYIGKTDSITISIWNHKKIHKRQGAGFLGCIRLLSNAISRLKDTGYQRLDLCK
LNPSDSDAVRGQIVVSLQTRDRIGSGGPVVDCRGLLENDGPVFEGCFSEEPLPYSDPTGA
AGGGNCRLDSPGQEGRLQTLRIRGPDSRGHGHTPQNRPHGHQPPDLPEGYEQRTTVQGQV
YFLHTQTGVSTWHDPRIPRRDLASVSCEELGPLPVGWEVRSTVSGRIYFVDHNNRTTQFT
DPRLHNIISHQSQVKETSQAPPMDVGVDEGGGGGIGGGGGGDGDMAVRYERDLVHKLKLL
RHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAR
EWLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGRVMGLAVFHSHY
INGSFTLPFYKQLLGKPIQLNDLETTDPELHKSLVWILENDITSVLDHTFCVEHNAFGKF
SQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFSELIPQHLLKPFDH
KELELIIGGLGKIDLADWKANTRLKHCTGESNVVRWFWQAVEAFSEERRGRLLQFVTGST
RVPLQGFKALQGSTGSAGPRLFTIHLIDANTENLPKAHTCFNRIDIPPYESYEKLYEKLL
TAVEETCGFAVE
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtcgaatcctgggagtcggagaaacgggtccagcatcaaaatccgactgacagtatta
tgtgccaagaacctcgcaaagaaagacttctttcgcctaccggatcctttcgctaaggtg
gtagtagacggatcgggtcaatgccactccacagacacagtcaagagcacactggatccc
aagtggaatcagcactatgacctctacatcgggaagacggactcgatcaccatcagcata
tggaaccacaagaagatccacaagcggcagggggcggggtttttgggctgcatacgactg
ctttccaacgccatcagcaggctaaaagacacaggataccagcgcctagatctttgcaag
ctgaacccctctgacagtgacgcagtgagggggcagatcgtagtgagcttacagacgcgg
gaccgcattggcagcggtggtcctgtagtggactgcagaggactgttggaaaacgatgga
cctgttttcgagggctgcttcagcgaagagccgctgccctactccgaccccaccggcgcc
gcgggcggcgggaactgtcggctggactcaccgggtcaggagggccgtctgcagactctg
cgaatcagagggccggactccagaggtcatggccacacccctcagaacagacctcacggg
catcaaccgcctgatctgccagagggatacgagcaacgaacaactgtgcaaggccaggtg
tacttccttcacacacagacaggtgtcagcacctggcacgaccctcggataccacgtagg
gatctggccagcgtgagctgcgaggaactcggcccgctgccagtggggtgggaggtccga
agcaccgtgtccggccgcatctactttgtggaccacaacaaccggaccacgcagttcaca
gacccccgtctgcacaacatcatcagccaccaatcccaagtgaaggagacgtcccaggcc
ccgccgatggatgtcggggtggacgaggggggaggcggagggattggcgggggcggagga
ggagacggagacatggcggtgcgctacgagcgagacctggtgcataagctgaagctgctg
cgccacgagctgtcgctgcagcaacctcaagcgggacattgtcgcattgaggtgtcccga
gaggagatctttgaggagtcgtatcgacagataatgaagatgaggccgaaggacctgaag
aaacggctgatggtgaagttcagaggagaggagggccttgattacggaggagtggccagg
gagtggctgtatctgctgtgtcatgaaatgttgaacccctactacggcctcttccagtac
tccactgacaatatctacacactacagatcaaccccgactcctccatcaaccctgaccac
ttgtcctattttcactttgtgggccgcgtgatgggcctggcggtcttccacagtcactac
atcaatggcagcttcacgctgcccttctacaagcagctgctaggcaaacccatccagctc
aacgacctggagaccacggacccggagttgcacaagagcctcgtctggatattggagaat
gacatcacttctgtcctggatcacactttctgcgtggagcacaatgcctttgggaagttc
tcccaacatgaactcaaacctaacggcagaaatgttcccgtcactgaggagaacaagaag
gaatacgttagactttatgtgaactggaggttcatgcgtgggattgaagcccagtttctg
gctctccagaaaggattcagtgagctgatcccacagcacctcctcaaaccgttcgaccac
aaagagctagagctaataatcggcggactggggaagatagacctggcggactggaaggcc
aacacccggctgaagcactgcaccggggagagcaacgtggtgcggtggttctggcaggcc
gtggaggccttcagcgaggagaggagagggcgcctcctgcagttcgtcacgggctccact
cgggttcccctgcaggggttcaaagcgctgcagggctctacaggttctgcaggaccgagg
ctcttcaccatccacttgatagacgccaacacagagaacctaccgaaagctcacacgtgt
tttaacagaatagacatccctccctacgagtcctacgagaaactttacgagaagctgctg
acagctgtggaggagacgtgcggctttgccgtggagtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114159826
Entry
114159826         CDS       T05908                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04120  Ubiquitin mediated proteolysis
xco04144  Endocytosis
xco04340  Hedgehog signaling pathway
xco04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114159826
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114159826
   04350 TGF-beta signaling pathway
    114159826
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114159826
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114159826
   04121 Ubiquitin system [BR:xco04121]
    114159826
   03029 Mitochondrial biogenesis [BR:xco03029]
    114159826
Enzymes [BR:xco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     114159826
Membrane trafficking [BR:xco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    114159826
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    114159826
Ubiquitin system [BR:xco04121]
 Ubiquitin ligases (E3)
  HECT type E3
   114159826
Mitochondrial biogenesis [BR:xco03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    114159826
SSDB
Motif
Pfam: HECT WW C2
Other DBs
NCBI-GeneID: 114159826
NCBI-ProteinID: XP_027897817
LinkDB
Position
16
AA seq 770 aa
MSNQGVRRNGPVKLRLTVLCAKNLAKKDFFRLPDPFAKVVVDGSGQCHSTDTVRNTLDPK
WNQHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLNKL
SPNDSDTVRGQIVVSLQSRDRIGTGGPVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCIVDENTPVSTNGATPTTASPPSDSNQRAQERRVRSQ
RHRNYMSRTHLHMHPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNVNCEEL
GPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNPSSNGSRGGSESQNVSR
QNQTKEQVQQALVSPGQLPEEAECLTVPKYKRDLVQKLKILRQELSQQQPQAGHCRIEVS
REEIFEESYRQVMKMRPKDLWKRLMVKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQ
YSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPIT
LDDMESVDPDLHNSLVWILDNDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVSQDNK
KEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKAFDEKELELIVCGLGKIDINDWK
SNTRLKHCTPDTSIVKWFWKAVESFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLF
TIHQIDASTNNLPKAHTCFNRIDIPPYETYDKLYDKLLTAIEETCGFAVE
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgtctaaccaaggagtccggcggaatggccccgtcaaactgagattaacagtcctgtgt
gccaaaaacctggcaaagaaagacttcttccgcctccccgatccgtttgccaaggttgtc
gtggacggttcaggccagtgccactccacagacactgtgaggaatacgcttgaccccaag
tggaaccaacactacgatctgtacatcgggaaatcggattcaatcaccatcagtgtgtgg
aatcacaagaagatacataagaagcaaggggctgggttcctgggctgtgtccgccttctg
tctaacgccatcaaccgccttaaagacacaggctaccagagactagacttgaacaagctg
agccccaatgacagtgacacagtccgggggcagattgtagtgagcctgcagtcgagggac
cgcatcggcaccggaggccccgtggtggactgcagtcggctgttcgacaacgatcttcca
gatggctgggaggagaggaggacggcgtctggacggatccagtacttgaaccacatcaca
cgcaccacgcagtgggagaggccgaccaggcccgcgtcggagtactccagccctggacgt
ccgctcagctgcattgtagacgagaacacgcctgttagcacgaacggcgccacgcccacc
accgcgtcgcctccgagcgacagcaaccagcgagcccaggagaggcgggtgcggtcgcag
cggcaccgcaactatatgagcagaacccacctgcacatgcacccagaccttcctgaggga
tacgagcaaaggacgacgcagcaaggtcaagtttacttcctccacactcagacgggtgtc
agcacatggcatgaccccagagtacccagagacctgagcaatgtgaactgtgaggaactc
ggtccgctgccgccgggatgggagatccgcaacaccgccacagggagggtctacttcgtc
gaccacaacaaccgaaccacgcagttcaccgacccgcgcctctccgctaacctgcatctg
gtcctaaatccaagttccaacggttctcgaggaggcagcgagagtcaaaatgtcagccgt
cagaaccagacgaaggagcaggtccagcaggccctggtgtccccgggccagctcccagaa
gaggccgagtgtctcaccgtgcccaagtacaagcgagacctggtccagaagctgaagatc
ctgcgccaggagctgtcccagcagcagcctcaggccggccactgtcgcatcgaggtgtcc
cgcgaggagatctttgaggagtcgtatcggcaggtgatgaagatgaggccgaaggacctg
tggaagaggctgatggtgaagttcaggggtgaagaaggcctcgactacggaggagtggcc
agggagtggctctacctgctctcgcatgagatgctgaacccgtactacggcctgttccag
tactcccgcgacgacatctacacgctgcagatcaacccggactccgccgtgaatcctgag
catttgtcgtacttccactttgtagggcgcatcatggggatggctgtgttccacggccat
tacatcgacggcggcttcaccctcccgttctacaagcaactgctgggtaaacccatcacc
ctggacgacatggagtctgtcgacccagacctgcacaacagcctggtttggatcctggac
aacgacatcacgggtgtgctggaccacaccttctgcgtggagcacaacgcgtacggcgag
atcatccagcacgagctcaaacccaacggcaagagcatccccgtctcccaggacaacaag
aaggagtacgtccgcctctacgtcaactggcgcttcctgcggggcatcgaggcgcagttc
ctggcgctgcagaagggcttcaacgaggtcatcccccaacacctgctcaaggccttcgac
gagaaggagctggagctgatcgtgtgcggcctggggaagatcgacatcaacgactggaag
tccaacacgcggctgaagcactgcacgccggacaccagcatcgttaagtggttctggaag
gccgtggagtcgttcgacgaggagcgccgggcccgactgctgcagttcgtcaccggatcc
tccagggttcccctgcaggggttcaaggcccttcaaggcgctgcagggccacgtctcttc
actatacaccagatcgatgccagcaccaacaacctgcccaaagcccacacctgtttcaac
cgaatcgacattcctccctacgaaacctacgacaaattgtacgacaagttgctcactgcc
atcgaagagacgtgcggcttcgccgtggagtga

DBGET integrated database retrieval system