KEGG   Xiphophorus couchianus (Monterrey platyfish): 114145015
Entry
114145015         CDS       T05908                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04060  Cytokine-cytokine receptor interaction
xco04068  FoxO signaling pathway
xco04144  Endocytosis
xco04218  Cellular senescence
xco04350  TGF-beta signaling pathway
xco04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114145015
   04350 TGF-beta signaling pathway
    114145015
   04068 FoxO signaling pathway
    114145015
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114145015
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114145015
  09143 Cell growth and death
   04218 Cellular senescence
    114145015
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    114145015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114145015
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     114145015
Protein kinases [BR:xco01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   114145015
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 114145015
NCBI-ProteinID: XP_027874134
LinkDB
Position
5
AA seq 598 aa
MNGFRSCLSNMHGPQCCSSSRGVSLPSSLVLWAVFFLPLLKPGTAGIPGMSMYPISRLCK
FCDRQSSSCNGTESCMSHCSITSVCDSREEVCVAIWIKNETSFTVETLCHNPSVSLYGIM
LDDYNSSSCVMKEKNSTSGMVHVCSCTEEECNDKMVFVPKAKDQAVGDSLISIILVSLLP
LIVMGVLVAAVIHWYCVNRRRHLSKKWESNVKMRKPKAGGLDCRDACAFMVDDDGSDSSS
IHANNLNHNTEPLPIELDLLVGKGRFAQVYKAKLKQSSSAQFETVAVKIFPSEEYASWKN
EKDIFSNKDLRHENVLHFLTAEERKAEKQYWLITAFHPSGNLQEYLTRHVISWEELQALS
SSLARGVAHLHSDRLASGRPKVPIVHRDLKSSNVLVKNDLTCCICDFGLALCLDSSLSVD
DLANSGQVGTARYMAPEVLEARLDLENIESFKQTDIYSMALVLWEMTSRCKTIGEVKDYE
PAFGSKVRQHPYVESMKDNDRPDIPDSWLRHQGILAICTTIKECWDHDPEARLTAHCVAE
RLSEIEEELDKLSSRSSSAEKIRYEVHIPVAMEIPEEEVKISEIQNIIAADCSVSDKK
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgaacggtttcagaagctgcctcagtaacatgcacggaccgcagtgctgctcatcgtca
cggggagtttcgttaccatcatcattagtattatgggctgttttctttttgccgctgctc
aaacctgggacagctggtataccaggcatgtccatgtaccccatcagtcggctgtgtaag
ttctgtgaccgacagagttcctcctgcaatggcacagagagctgcatgtcccactgctcc
attacgtctgtctgtgattcgcgtgaagaggtctgtgttgctatatggataaagaatgag
accagcttcaccgtggagaccctttgccacaacccgtccgtgtcgctgtacggcatcatg
ctggacgactacaacagctccagctgtgtgatgaaggagaagaactccaccagcgggatg
gtgcacgtctgttcctgcacagaagaagagtgtaatgacaaaatggtgttcgttcccaaa
gcaaaagatcaagccgtgggcgattccctcatctctattattctggtaagcctgcttccc
cttattgtgatgggagtcttggttgccgcggtgatccactggtactgcgtcaatcggcgg
cgccatcttagcaagaagtgggagagcaacgttaaaatgcgtaagccaaaagccggcggg
ttggactgcagagacgcctgcgccttcatggtggatgacgacggctctgacagcagctcc
attcacgccaacaacctgaatcacaacaccgaacctctgcctatagagctggatctgctg
gtgggtaagggccgcttcgctcaggtgtacaaggcaaagctgaagcagagcagctcagct
cagtttgaaaccgtggctgtgaagatcttcccctctgaggagtacgcatcctggaagaac
gagaaggacatcttttccaacaaggacctcagacatgagaacgtcctccactttctgaca
gctgaggagaggaaggcagagaaacagtactggctcatcacagctttccaccccagtggg
aacctccaggagtatctgacgcgccacgtgatcagctgggaggaactgcaggcgttgagc
agctctctggcccgcggagtcgcccaccttcacagcgaccggctcgcaagtggacggccc
aaggtgcccatagttcacagagacctaaagagctccaacgtgctggtgaagaacgacctg
acctgctgcatatgtgactttggcctggcgctctgtctggacagcagcctgtcagtggat
gatctcgccaacagcggccaggtgggtacggcgcgctacatggcccctgaggtcctggag
gcccggctcgatctggagaacatcgagtccttcaagcagaccgacatttactccatggct
ctggtcctgtgggaaatgacatcaagatgcaaaaccataggagaggtgaaggactatgag
ccagcgttcggctccaaggtgcgacagcacccctatgtggagagcatgaaggacaacgac
agacccgacatccccgacagctggctccggcatcagggcattttggctatctgcaccact
atcaaggaatgctgggaccacgacccggaggcccgtctcacggcccactgcgtggccgag
cgactctctgagatcgaggaggagctggacaagctgtcgagccgcagctcctcggctgag
aagatccgatacgaggtgcacatccccgtcgccatggagatcccagaggaggaggtgaag
atctccgaaatccagaacatcatagctgcggactgctctgtgagcgacaagaagtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114149782
Entry
114149782         CDS       T05908                                 

Definition
(RefSeq) TGF-beta receptor type-1-like isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04060  Cytokine-cytokine receptor interaction
xco04068  FoxO signaling pathway
xco04144  Endocytosis
xco04218  Cellular senescence
xco04350  TGF-beta signaling pathway
xco04371  Apelin signaling pathway
xco04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114149782
   04350 TGF-beta signaling pathway
    114149782
   04371 Apelin signaling pathway
    114149782
   04068 FoxO signaling pathway
    114149782
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114149782
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114149782
  09143 Cell growth and death
   04218 Cellular senescence
    114149782
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    114149782
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114149782
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     114149782
Protein kinases [BR:xco01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   114149782
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 114149782
NCBI-ProteinID: XP_027881685
LinkDB
Position
8
AA seq 503 aa
MDAIACFLMVLLSWTRLHDIDALQCYCDRCSSNSSCTTDGVCFVAIKKSGSQQISEQRQC
IHDSELIPRDRPFVCAPNSRTDTGIFPMCCSSDYCNKEPNFTVFPEEEKPQSLGPVALAA
VIACPVCVLCLLLILAFYICHNQRGLGAGGAGALHHRVPNEEDPSMDHPFITVGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIILQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLSLSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIASRCSVGGI
HEDYQLPYYDLVQSDPSVEEMKKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggatgcaatagcatgctttctgatggtccttctgtcctggacaaggttacatgatatt
gacgccctccagtgttactgtgaccgctgcagctccaactccagctgcaccacagatggc
gtctgctttgtggccattaagaagtcggggagccagcagatctcagaacagcgtcagtgc
atacatgacagcgaactgatccctcgagacagaccctttgtatgcgccccaaactccaga
acggacaccggcatcttccccatgtgctgctcgtctgactactgcaacaaggagccgaat
ttcacagtctttccagaagaagaaaagccccagtctttgggccccgtggccctcgctgcg
gtgattgcatgcccagtgtgtgtgctgtgtctgctgctcattttggcattctacatctgc
cacaaccaaagaggtctgggtgctggcggagcaggggccctccaccaccgtgtgcccaat
gaggaggacccctccatggatcaccccttcattactgttggaacaacactcaaagacctc
atctatgacatgaccacatccggctctggatcaggcctgcctctgctggtccagaggacc
atcgccagaaccatcatcctgcaggagagcattgggaagggacgttttggcgaggtgtgg
aggggtaagtggcgtggtgaggaggtggcggtgaagatattctcctccagagaagagcgc
tcctggttccgtgaggctgagatctaccagacagtcatgttgcgccacgagaacatcctg
ggctttatcgctgccgataacaaagataacggaacctggactcagctgtggctggtgtca
gactaccatgaacacggctccctgtttgactacctgaaccgctacacggtcactgtggag
ggcatgatcaagttgtccctgtccaccgcaagcggcctggcccaccttcacatggagatt
gtagggacacaaggaaagccagctatcgctcacagagatctaaagtccaagaacatcctg
gtgaagaagaacgggacctgctgcatcgctgacctgggtctggctgttcgacacgactcc
gccaccgacaccatcgacatcgctccaaaccacagagtgggaaccaaaagatacatggct
ccagaggtgctggatgactccatcaacatgaagcactttgagtcgttcaaacgggccgat
atctacgccatgggcctggtgttctgggagattgccagccgctgctctgtgggaggcatt
catgaggactaccagctaccctactatgacctggtccagtcagatccatcagtggaggaa
atgaaaaaggtggtctgcgagcagaaacttcgaccaaatattcccaaccgctggcagagc
tgtgaggctctgcgggtcatggctaagatcatgagggagtgttggtacgccaacggtgcc
gcccggctcaccgcgctacggatcaagaagacactgtctcagctcagccagcaggaggga
atcaagatgtag

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114156140
Entry
114156140         CDS       T05908                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04060  Cytokine-cytokine receptor interaction
xco04068  FoxO signaling pathway
xco04144  Endocytosis
xco04218  Cellular senescence
xco04350  TGF-beta signaling pathway
xco04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114156140
   04350 TGF-beta signaling pathway
    114156140
   04068 FoxO signaling pathway
    114156140
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114156140
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114156140
  09143 Cell growth and death
   04218 Cellular senescence
    114156140
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    114156140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114156140
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     114156140
Protein kinases [BR:xco01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   114156140
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal Zn_peptidase_2 S1FA
Other DBs
NCBI-GeneID: 114156140
NCBI-ProteinID: XP_027892198
LinkDB
Position
13
AA seq 539 aa
MELLRFSVFCCGAVLFGIVLLPVETNTSMIAIKQLCRFCDLQATTCLGKGICKVDCDITS
ICPDDNDVCVSIWRKKDNNITFETVCHNPANPLYGLYLDDYNNTKCIMKEKKAKDSKFFI
CSCSKEEECNDNIIFNPHSQVGPVILVSLLPLLVIAIFVITSFYCYRIYSQQGNPRKKGK
PLDNTDKHPIIDNEGSDSSSTHANNLNHNTELLPIELDVLVGKGRFAEVYKAKLKQGSSV
REEHGFETVAVKIFQFEEYASWKNEKDIFSDADLRHENVLHFLTAEERKGQRQYWLITAY
HPLGNLQEYLTNHIISWHDLWLLGSSLARVVAHLHSDRTSCSRFKVPIAHRDIKSSNILV
KKDMTCCLCDFGLALRLDNSLSVDELANSGQVGTARYMAPEVLESRINLENIESFKQADV
YSMALVLWEIISRCSAIGEVKEYKPPFGNLREHPCVESMKDSVLRDRGRPEIPNSWTSHA
GIQMVCGSIEECWDHDPEARLTAHCIAERFDDVEYLDKLSDCSDSEEKMLEEIIVVDEK
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggagctgcttcggttttccgttttctgctgcggagcggtcctgttcggtattgtgctt
ctgccggtggagacgaatacctccatgatcgctataaaacagctgtgcaggttttgtgat
ttgcaggccaccacgtgtctcggtaagggaatctgcaaggtggattgtgacattacctcc
atctgccctgatgataacgacgtgtgtgtcagcatctggcggaagaaagacaacaatatt
acatttgaaacagtttgtcacaatccagctaatcccctgtatggcctgtacctggacgat
tacaacaacacaaagtgcattatgaaagagaaaaaggccaaagactcaaagtttttcatc
tgctcctgttccaaagaggaggagtgcaatgataacatcatttttaacccacactctcag
gttgggcctgtcatcctggtcagcctgctgcctcttctggtcatagccatttttgtcatc
acttcgttctactgttaccggatctacagtcaacagggaaaccctcgcaagaagggcaag
ccactggacaacaccgacaagcaccccatcatagacaacgagggttcagacagcagctcc
acgcacgccaacaacctgaaccacaacaccgagctcctgcccatcgagctggacgttctg
gtcggtaagggccgctttgccgaggtctacaaagccaagctgaagcaaggctcgtcggtc
cgggaggagcacggctttgaaacggtggcagtcaagatcttccagttcgaggagtacgcc
tcctggaagaacgagaaggacattttctcagacgcagacctcaggcatgaaaacgtgctt
cacttcctcacagcagaggagaggaaggggcagaggcagtactggctgatcacagcttac
catccactggggaacctccaagagtacctaaccaatcacatcatctcctggcacgacttg
tggctgctggggagctcgctggcccgtgtagtggcacacctgcacagtgaccgcacttcc
tgcagccgcttcaaggttcccatcgctcacagggacattaaaagctcaaatatactcgtg
aaaaaggacatgacctgctgcctgtgtgactttggcctcgcacttcgactggacaactct
ctgtctgtggacgagttggccaacagcggacaggtgggcacggccagatacatggctcct
gaggtgctggagtccagaatcaatctggaaaacatcgagtctttcaaacaagcagacgtt
tactccatggctctggtgctgtgggagatcatctccagatgcagcgcgatcggagaggtg
aaggagtacaagcccccctttgggaacctgagggagcacccatgtgtggagagcatgaag
gacagcgtcctccgagacagaggaagacccgagatccccaacagctggacgagccacgca
ggcatccagatggtgtgcggctctatagaggagtgctgggaccacgacccggaggcccgc
ctcaccgcgcactgcatcgccgagcgcttcgacgacgtagagtacctggacaagctgtca
gactgctccgactcagaggaaaagatgctggaggaaatcattgtggtggacgagaagtaa

DBGET integrated database retrieval system