KEGG   Xiphophorus couchianus (Monterrey platyfish): 114145203
Entry
114145203         CDS       T05908                                 

Gene name
hhip
Definition
(RefSeq) hedgehog-interacting protein isoform X1
  KO
K06231  hedgehog interacting protein
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114145203 (hhip)
SSDB
Motif
Pfam: GSDH EGF_2
Other DBs
NCBI-GeneID: 114145203
NCBI-ProteinID: XP_027874468
LinkDB
Position
5
AA seq 697 aa
MKHLQFVLVLAIAVNVWECGDAKFGERGELSPRRRRCYDGSLPKRLKKRERKVLLDGSSS
GEVCHRLYPRVSCCPTRRAAYQILHRGDARIFSTNNTECGHLLEEIKCARCSPNAQVLFH
SLDMDRMPHREPDLPRLCQDFCREFYYTCRGHIPELFQADVDEFCQYYGRRGAGLCFPDY
QRRQLLGQDSNYLEDEKIEDISRKHKHNCYCPQEVLSGLRQPVAVVHCGDGSQRLFVVER
EGIVRILNHNLEVIKEPFLDLHKLVQSGLKSGDERGLLSLAFHPNYKKNGKLYVSYTTNQ
ERWAIGPHDHILRVVEYTVSRKNPNQVDTRTAHVLMEVAELHRKHLGGQLLFSPDGLLHI
ILGDGMITLDDMEEMDGLSDFTGSILRVDVDTDICTSSYSIPRNNPYFNSTNQPPEIFAH
GLHDPGRCAVDRLQTDNGSLVILCTDASGKNTSAGRILEVTKGKDYENEPSVYDLQSSGG
APPVGGFIYRGCQSRRLYGSYVFGDRNGNLRILQKSPFATSSDSEQWQEKALCLGSVSCA
SPLVGHVLGFGEDELGEVYILASSKSVAQSHSGKLYKLVDPKRPHSPKECQRPVEPPELL
MTACSRNCKNGHCTPTGKCCCSPGWEGPFCRIAKCEPACRNGGVCIEPNKCLCKSGYSGA
QCEKSERGMPNDQEKDGILDHIIDMTSYLLDLTTYIV
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgaagcacttgcagttcgtgctcgtcctggccatcgcggtgaacgtgtgggaatgtggg
gacgcaaagttcggtgagagaggagagttgagccccaggaggagaagatgctacgacgga
agcttgcccaagcgactgaagaaaagggagcgaaaagtgctgcttgacggcagcagcagc
ggagaagtttgccataggttgtacccccgtgtgtcctgttgtcccaccaggagagccgcc
tatcagatcctgcaccgcggggatgcccggattttctccaccaacaacacagaatgtgga
catctcctggaggagatcaagtgtgcacgctgctcccccaatgcccaggtgttgttccac
tccttggacatggatcggatgccacacagagagccggacctgccgcggctctgccaggac
ttctgccgggagttctattacacctgcagggggcacataccagagctgttccaagctgat
gtggatgagttctgtcagtactatgggaggagaggtgctggcttgtgttttcccgattat
caacgaaggcaactacttgggcaagattccaactacttggaagatgagaaaatagaagat
atcagcaggaaacacaaacacaactgctactgtcctcaggaggtgttgagtggcctgagg
cagccagtggctgtggtgcactgtggcgatggctctcagcggctttttgttgtggagaga
gagggaattgtcaggatactcaaccataacctcgaagttatcaaggagcccttcttggat
ctccacaagctggtgcagagcggactgaagagtggtgatgaaaggggcctgctaagcctg
gcattccaccccaattacaagaagaatggcaagctatacgtctcctacaccaccaaccaa
gagcgctgggccatcggaccgcacgaccacattctccgtgtggttgaatacaccgtttca
aggaaaaacccaaaccaggtggacaccaggactgcccatgtgctgatggaagtggctgag
ttgcacaggaagcacctcggaggtcagcttctgttctctcccgatggtctgctgcacatc
attctgggagacggtatgatcactctggacgacatggaggaaatggatggactcagtgat
ttcacagggtccattctaagggtggacgtggacacggacatttgtacgtcgtcctactcg
ataccacggaacaatccgtactttaacagcactaatcagccacctgagatctttgcacat
ggattacatgacccaggcaggtgtgcagtggatcggctgcagacagacaacggcagtctg
gttatcctctgcacagacgccagtggtaaaaacacatcggcaggaagaatattagaagtt
actaaggggaaggattatgaaaatgagccttctgtgtatgacctgcagtccagtggagga
gcgccacctgtggggggcttcatctataggggctgccagtcgaggagactgtatggcagc
tatgtgtttggagatagaaatggtaacctgcggatcctccagaagtctccctttgccaca
tcgtctgacagcgagcagtggcaggaaaaggctctgtgtctgggctcggtttcctgcgcc
tctcccctcgtggggcatgtcttgggtttcggagaggatgaactcggtgaagtctacatt
ctagcgagcagtaaaagcgtggcacagtcacacagcgggaaactctacaagttggtagac
ccgaaaaggcctcattcccccaaggagtgtcagcgcccggtggagccaccagagctacta
atgacagcttgctccagaaactgcaaaaacggacattgcactccgactggcaagtgctgc
tgcagccccggctgggagggacccttctgccgaatagctaaatgtgaaccagcctgtcgc
aacggaggagtctgcatagagccaaataagtgcctgtgtaagagcggctactctggcgct
caatgcgagaagagtgagcgggggatgcccaacgaccaggagaaggacggcatcctggat
cacatcatcgacatgacctcgtacctcttggacctgaccacctacatcgtatag

DBGET integrated database retrieval system