KEGG   Xiphophorus couchianus (Monterrey platyfish): 114146495
Entry
114146495         CDS       T05908                                 

Gene name
bcl2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04115  p53 signaling pathway
xco04140  Autophagy - animal
xco04141  Protein processing in endoplasmic reticulum
xco04210  Apoptosis
xco04217  Necroptosis
xco04261  Adrenergic signaling in cardiomyocytes
xco04340  Hedgehog signaling pathway
xco04510  Focal adhesion
xco04621  NOD-like receptor signaling pathway
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114146495 (bcl2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114146495 (bcl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114146495 (bcl2)
  09143 Cell growth and death
   04210 Apoptosis
    114146495 (bcl2)
   04217 Necroptosis
    114146495 (bcl2)
   04115 p53 signaling pathway
    114146495 (bcl2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114146495 (bcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114146495 (bcl2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114146495 (bcl2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114146495 (bcl2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114146495 (bcl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xco01009]
    114146495 (bcl2)
Protein phosphatases and associated proteins [BR:xco01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114146495 (bcl2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 114146495
NCBI-ProteinID: XP_027876399
LinkDB
Position
6
AA seq 229 aa
MANDYNRIIVENYICHKLSKRGYVWGFNGVPDDDAANNGGLGDHSPTLVRRCRDAGPGPD
RDSDPHSLCRRISQSDPYADIHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAE
VINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQVDNIAEWMTEYLNGPLDSWIQD
NGGWEAFVELYDRQKESVFSCYWPSIKTVFGLAALGAASVTIGAYLAQK
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcgaacgactacaatcgcattatcgtggaaaactacatctgccataaactctccaaa
cggggatacgtgtggggatttaacggagtcccggacgacgacgctgctaataacggaggc
ttaggtgaccattcaccgactttggttcggcgatgtcgcgatgcaggaccggggcccgac
agagacagcgacccccacagcctctgcaggcggatctcgcagtccgacccgtatgcagac
atccaccgggtcctgcgcgacgccggggacgaactcgagaaactgtaccagttggacttc
gtggagatgtcgcagcagctgtacctcaccagagacacggcgaggactaggttcgcggag
gtcataaacgaactgttccgggacggggtgaactggggtcggattatcgctttcttcgag
ttcggaagcacggtgtgcgtggagtgcgcgtccaaagaggagatgacatcgcaggtggac
aacatcgcggagtggatgacggaatatttaaatggaccccttgacagctggatacaagat
aacgggggatgggaagcgtttgtggaactgtacgacagacaaaaggagtcggtcttcagc
tgctactggccgtccatcaagactgtctttggcctggctgcgctcggagcggccagcgtc
accatcggagcgtaccttgcacaaaagtga

DBGET integrated database retrieval system