KEGG   Xiphophorus couchianus (Monterrey platyfish): 114146891
Entry
114146891         CDS       T05908                                 

Gene name
ptch2
Definition
(RefSeq) protein patched homolog 2
  KO
K11101  patched 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114146891 (ptch2)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 114146891
NCBI-ProteinID: XP_027877125
LinkDB
Position
6
AA seq 1487 aa
MASDRGVPGSGVFGDLPPSYTRSQPPAHPDLQRRPSYCHAAFALKQISKGKAVGQKAPLW
IRARFQAFLFSLGCHIQRHCGKVLFIGLLVFGALSVGLRVAAIETNIEQLWVEAGSRVST
ELRYTREKQGEESVFTSQMLIQTPKEEGTNILTQEALLVHMEAALSASKVQVSLFGKSWD
LNKICYKSGVPIIENVMIERMIDKLFPCMIITPLDCFWEGAKLQGGSAYLPGMPDIQWMN
LDPVKLMEELGQYTSLEGFKEMLDKAQVGHAYMDRPCLDPSDPDCPLSAPNKEQEESPDI
AGRLQGGCHGFSQKFMHWQEELILGGRVKSSQDALLSAEALQSMFLLMSPKQLYEHFKDD
YEIHDINWNAEKATAILESWQRKFVEVVHQSIPGNSSQSIHAFSTTTLNDIMKSFSDVSV
IRVAGGYLLMLAYACVTMLRWDCAKSQGAVGLAGVLLVALSVAAGLGLCSLLGLSFNAAT
TQVLPFLALGIGVDDMFLLAHSFTEAGSNIPFKERTGDCLRRTGTSVALTSINNMIAFFM
AALVPIPALRAFSLQAAIVVVFNFAMVLLIFPAILSLDLHRREDKRLDILCCLYSPCADR
VIHLSPHELSEAGEQSQAPGSGTAHAHQYAAGPTITTSTQITTTVQAFTQCDAAGQHIVT
ILPPTSQISTSSPSIIVCPTTQTQAASPSPTTTSVPDHYGSQLFTPTSSSTRDLLAQVED
SKSGKECVPLPFLHWNLSKFAREKYAPLLLKPKSKVAVVVLFLGLLSLGLYGTTMVHDGL
YLTDIVPRDTKEYDFIDAQFKYFSFYNMYLVTMDGFDYARSQRLLIQLHNAFNSVKYVVR
DSDNKLPRMWLHYFQDWLNGLQAAFDADWQAGRITVDSYRNGTEDGALAYKLLIQTGSKK
EPFNHSQLTSRRLVDGEGLIPPEVFYIYLTVWVSNDPLGYAASQANFYPHPREWIHDKYD
TTGENLRIPSAEPLEFAQFPFYLNGLRQASDFVEAIESVRAICDEFSRKGVLNYPNGYPF
LFWEQYIGLRHWFLLSISVVLACTFLVCAILLLNPWTAGIIVFILAMMTVELFGIMGLIG
IKLSAIPVVILIASVGIGVEFTVHIALGFLTAIGNRNKRTAVALEHMFAPVVDGAISTLL
GVLMLAGSEFDFIMRYFFAVLAILTVLGMLNGLVLLPVLLSMLGPPAEVTPVDNASCLPT
PSPEPPLPPPMAHHGYFTAHNHPRSPRQQAFSESSDSEFYSEVTTTSGIGEEDYKYCDRN
AYQTTAPSTTSHILVEASKNPSFPKLTVLKPFRENAVGGRVEPLCESNHNLQPPVGSQVT
CWDGNKREQQSDLQRLQDQSPQRLPSDKAHFPGRTCQSGPRLQNSRGPQPNRTKGPSYGH
SNSSLPMQQGPSGGPVTMVTATASVTVAVHPTLPGTAYQGYMHEGFDVDSELDCFEAAKR
TCGDKTKYSACNRDSLELQDLEVTQVQTEYQLGKSQGGLRIQASTDC
NT seq 4464 nt   +upstreamnt  +downstreamnt
atggcctcggatcgcggggtcccagggtccggcgtctttggagatttacccccgagttat
acgcgctctcagccgcctgcgcacccagacctgcagcggagacccagctactgccatgcc
gctttcgcacttaaacagatctcaaagggaaaggcagtaggtcagaaagctcctctatgg
atccgggcgaggttccaggccttcctgttctctctgggctgccacatccagaggcactgc
gggaaggtgctctttattggactcttggtgttcggggctctgtctgtgggactccgggtg
gcagccatcgaaaccaacatcgagcagctctgggtggaagctggcagtcgggtgagcaca
gaacttcgctacaccagagagaagcagggagaggagtcggtgtttacctcgcagatgctc
atccagacacccaaagaagagggcacgaatattttgacgcaggaggctttgctggttcac
atggaggccgcactgtcggccagcaaggtgcaggtgtcgctgtttggaaaatcgtgggat
ctcaataaaatatgctacaaatcaggagttcctattatagaaaatgtcatgattgaaagg
atgattgacaagctattcccatgtatgataatcactccattggactgtttctgggaaggg
gccaaactacaaggaggttctgcctacttaccgggcatgccagatatccagtggatgaat
ttagatcctgtcaagctgatggaagaactgggccagtacacatccctggaaggttttaaa
gagatgttggacaaagcccaggtgggacacgcctatatggacaggccgtgcctcgaccca
tcagacccggactgccctctcagtgcccccaataaggaacaggaagaaagtccggacatt
gccgggcgtctccagggtggatgccacggcttcagtcagaagttcatgcactggcaggag
gagctcatcctgggagggcgtgtcaaaagcagccaggatgccctactaagtgcggaggct
ctccaatccatgttcctgttgatgagtcccaagcagctctatgaacacttcaaggacgac
tatgagatccacgacatcaactggaatgcggaaaaggccaccgccatcctcgagtcctgg
cagaggaagtttgtggaggtcgtccaccagagtattcctggtaattccagtcagtctatc
catgccttctccacaaccaccctcaacgacatcatgaagtccttctctgacgtcagtgtc
atcagagtcgctggaggatacttgctcatgttggcctatgcctgtgtgacgatgctcagg
tgggactgtgccaagtcgcagggggctgttggactggcgggggtgctgctggtagccctg
tcggtggcagcaggactgggactctgctctctacttggcctctctttcaatgctgctact
acacaggtgcttcccttcctggcactggggattggtgtagatgacatgtttctgttggcg
cactccttcacggaggcaggaagtaatatcccctttaaggagcggacaggagactgcttg
cgtcgcaccggcacaagtgtggctctgacttccataaacaacatgattgcattcttcatg
gctgccctggtgcccatcccagccttgcgggcattctctctgcaggcagccattgtggtg
gtgtttaattttgccatggtgctgctcatcttccctgccatcctcagcttggacctccac
cggcgcgaggacaaacgcttggacatcctctgctgcctgtacagcccgtgcgctgatcgc
gtcattcacctctcgccgcatgagctgtcagaagccggcgagcagtctcaggcgcccggg
tcggggacagcgcatgcgcaccagtatgctgcaggaccgacaatcaccaccagcacccag
atcaccacaacagtgcaagcgtttacgcagtgcgacgcagcgggtcagcatatcgtcaca
attctgccaccaacttcacagatctccacaagctctccctccatcattgtctgccccacc
acacagactcaggctgcgtcaccttccccgaccaccacctctgtgccagaccactacggc
tcccagctcttcaccccgacttccagctccacgcgggacctcctagcccaggtcgaagac
tccaaatcggggaaggagtgcgttccactccccttccttcactggaacctgtctaagttc
gcccgggaaaagtatgctcccctacttctgaagcccaagagcaaagtcgcagtggtggtt
ctcttcctgggacttctcagcctcgggctatacgggaccaccatggtgcatgacggcctc
tacctgaccgacatcgtgccccgtgataccaaggagtatgacttcatcgatgcacagttc
aagtacttctccttctacaatatgtacttagtgacgatggatgggttcgactacgcccga
tctcagaggctgctgattcagctgcacaacgccttcaactctgtcaaatacgtagtccga
gacagcgacaacaagctgccccgcatgtggctgcactacttccaggactggctgaacggt
ctccaggctgcttttgatgctgattggcaggcgggccggattacagttgacagctacagg
aacggcaccgaagatggagctctggcgtacaagctgctcatccagacaggctccaagaaa
gaacctttcaaccacagccagttgacttctcgccggctggtggatggcgagggtttgatc
cccccggaggtgttttacatttacctgaccgtgtgggtcagtaatgatcccctgggctat
gccgcatcccaggccaacttttatcctcaccccagagagtggattcatgacaagtatgac
accacaggagaaaatctgcgcatcccctcagcggaacccctggagtttgctcagtttccc
ttctacctgaatggccttcggcaggctagtgacttcgtggaggccatcgagagcgtgcgt
gccatttgtgatgagttcagccgcaagggcgtgctcaactaccctaacggttaccccttc
ctgttctgggaacagtacatcggcctccgtcactggttcctgctgtcaattagcgttgtg
ctggcctgtaccttcctggtatgcgccattctcctgctcaacccctggacggctggcatc
attgtgtttatcttggccatgatgacggtggagttgtttggcatcatgggcctgattggc
atcaagctcagtgccattcctgtggtcatcctgatcgcatcggtgggcatcggtgtggag
tttacggttcacattgccctgggcttcctgacagcaattggcaacagaaacaagcgcaca
gcggtggcactggaacacatgttcgccccagtggttgatggtgcaatctccacattgctg
ggtgttctcatgctggcgggttcagagtttgacttcatcatgaggtatttttttgccgtc
cttgccattctgactgttttggggatgctgaatggcttagttctcctcccagtcctcctt
tccatgctgggccctccagctgaagtcaccccagttgacaatgccagctgcctgccgaca
ccttctcccgagccaccgctgcctcctcccatggcccaccacggatactttacagcccac
aaccatccacgctcgccacggcagcaagcgttttctgagtcgtcagattctgaattctac
tccgaggtgacgacgacctctgggatcggggaggaggactataagtactgtgacaggaac
gcgtaccaaacgacagctccttccacaacgtcccacatactggtggaagccagcaagaac
ccaagcttccccaaactaacggtgctgaagccctttagggaaaacgcagtcggtgggagg
gttgaaccgttatgtgaatccaaccacaatctgcaaccacctgttggctcccaggtaaca
tgctgggatggaaacaagcgtgagcagcagagcgatcttcagagactgcaggatcagtcg
cctcaacgcttacccagcgacaaagctcatttccctgggaggacttgtcaaagtggcccc
aggctgcagaacagcagagggcctcagccaaacaggactaaagggccgagctacggtcac
agcaactcttccctgccaatgcaacaaggcccctctgggggccctgtcaccatggtgact
gctacagcctccgttacggtggctgtgcacccgacgttaccggggacagcttatcaaggc
tacatgcatgaaggttttgacgtggacagcgagttggactgttttgaagctgctaaaagg
acttgtggcgacaaaacaaaatattctgcatgtaacagagactctctagagctccaagac
ttggaggtgacacaagtccagacggaatatcaactcggcaagtcacaaggtgggctgagg
atccaggcatctacagactgctag

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114154713
Entry
114154713         CDS       T05908                                 

Gene name
ptch1
Definition
(RefSeq) protein patched homolog 1
  KO
K06225  patched 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114154713 (ptch1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 114154713
NCBI-ProteinID: XP_027889849
LinkDB
Position
12
AA seq 1562 aa
MASAANAPFEQENRDPDRPRITRRNRGDYTRGTPLDLEYLQRPSYCDAGFALEQISEGKA
TGRKAPLWLRAKFQRFLFRLGCYIQKNCGKFLVVGLMIFGAFAVGLRAANLETDVEKLWV
EVGGRVNQELKYTRQKMGEEAMFNPQLMIQTPREEGANILTVEALLQHLESALRASRVHV
YLYNRQWKLEHLCFKSGELVTETHFMNQIIEKLHPCLIITPLDCFWEGAKLHSGMVYLPG
ENPMQWTNFDPREFLEKLRRAHIHVDSFEDMLEKADVGHGYMDRPCLNPADPDCPDTAPN
KNSTKPFNVARALSGGCHGLSRKYMHWQEELIVGGTTKNGSGPLLSAQALQTMFQLMTPK
QMFEHFRDWDEVSHINWNEEKAAAILEAWQRRYSEAVLHSVATNSSQKVLSFTTTTLEDI
LKSFSDISVIRVASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVTLSVAAGLGLCSL
LGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVAL
TSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREERRFDI
FCCFYSPCANRVIQIEPQAYLDGADVGHYSPPPSYRTSPPSYHTPPPSYSSHSFAQQTQI
TMQSTVQLRTEYDPRTQAFYTTAEPRSQISVQPINPVQTRGNHSGDYYNNNNNVSRSSMN
SRGSNLGNNHGGSRGNGGSSGSVAFTHHCPAPTSGTCTVPQGDSASTTSHSPENNSSTRD
LLSQIGEASMGLHCLEPSCSRWTLASFAEKHYAPFLLRPTTKVVVIMLFLGLLGISLYGT
TQVRDGLELTDIVPRETSEYDFIGAQFKFFSFYNMYVVTQRAKYAQSQPLLHQLHQRFHT
IRYVLKEDNGQLPRMWLHFFRDWLQGLQQAFDKDWEAGHITVNSYKNGSDDGVLAYKLLV
QTGRRDKPINFSQLTRQRLVDADGIINPGAFYIYLTAWVSNDPVAYAASQANIRPHPPEW
LHDRTDSMPETRLSIPAAEPIEYAQFPFYLNGLRETPQFVEAIESVRAICNNYSQQGLPS
YPNGYPFLFWEQYISLRHWLLLSISVVLACTFLVCALFLLNPWTAGIIVLVLSLMTVELF
GFMGLMAIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDRHKRAVLALEHMFAPVLD
GAFSTLLGVLMLAGSEFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSYFGPYPEVSPTD
DRSRLPTPCPESPPRVVHFSVRPHQTSGPVTNSGAATDSSDSEYSSNATVSGISQEVQNY
NLYPHRGQTQPEEQHHHLRTSRGRVARPEEERRVGSGQRHSPRQQPDPPAYTVSSFVPSQ
GCDSGLQHGNTQRNCSRDPRGQQHWQASPPAQPRMDAFETATEAGGHHTSRSYREHSAGH
SNHSSHNSQPHHHQQHHHHLPHQHTNNAPFCQPITTVTASASVTVAVHPVPFSTQGPASS
FPEYTGTDSYYPSGPEESESAFQDPHVPLYTHTGGREAKVESVELQDLELEAADTNHGQQ
AS
NT seq 4689 nt   +upstreamnt  +downstreamnt
atggcctcggctgctaatgcgcccttcgagcaggaaaacagagaccccgatcggccgagg
ataacgcggaggaacaggggggactatacccgcggcacaccgctggatttggagtatttg
cagcggccgagttactgcgatgcgggcttcgctctggagcaaatatcagaggggaaggcg
actgggaggaaagcacctctgtggctgagagcgaagttccagagattcttattcaggctc
ggctgttacatacaaaagaactgtggaaagtttttagttgtgggccttatgatttttgga
gcttttgccgtgggtttaagggcagctaatctggaaacggacgtggagaaactctgggtg
gaagttggtgggcgtgttaaccaggaactgaagtacacacgacaaaagatgggggaagag
gccatgtttaaccctcagctgatgatccagacaccgcgggaggagggagccaacatacta
acggtggaggcccttctacagcacctggagtctgctctccgagccagcagagttcatgtt
tacctttataacagacaatggaaattggaacacttatgcttcaaatcaggagaactagtc
acagaaacacattttatgaatcagattatagaaaagcttcatccctgcctcatcatcacc
cctttggactgtttctgggaaggagctaaactccactctggaatggtctatctcccaggt
gagaaccctatgcaatggaccaattttgaccccagggagtttcttgaaaagttacgaaga
gcacacatacatgtggatagctttgaggacatgttggaaaaagcggacgttgggcatggc
tacatggataggccctgtctgaaccctgctgaccctgactgccctgatactgcacccaat
aagaactcaactaagccgttcaacgtggcacgggctttgagtggtggctgccacggtctg
tccaggaagtacatgcactggcaagaggaactcattgtagggggcaccacaaagaacggc
agcggacccctactcagtgctcaggctttacagaccatgttccagttgatgacccccaag
cagatgtttgagcactttcgggactgggatgaggtttcccacatcaactggaatgaagaa
aaggccgcagctatactggaagcctggcagaggagatactctgaggcagtgctgcatagt
gtggcaacaaattcttcccaaaaggtcttgtcctttaccaccactactctggaggatatt
ctcaagtctttttctgatatcagtgttatccgggtggccagtggatacctgctgatgctg
gcatatgcgtgtctgaccatgctgcggtgggactgtgccaagtcccagggtgccgtgggg
ctggctggagtccttctggtgacgctgtctgtggcggccggtctgggcctctgttctctc
ctgggaatctccttcaatgctgccaccacgcaggttcttcccttcctggctctgggagtt
ggagtggatgatgtcttcctcctcgcccatgccttcagtgagactggacagaacaagagg
ataccgtttgaggaccgcactggggagtgtctgaagaggactggggccagcgtggctctc
acctccatcagcaacgtcacagccttcttcatggcagccctcatccccatcccagcactt
cgagctttttctttgcaggccgcggtggtagttgtgtttaacttcgccatggtgctgctc
atctttcctgccatcctcagcatggatctctacagacgagaagaaaggcgctttgacatc
ttctgctgcttctacagcccatgtgccaatcgagtgattcaaatcgagcctcaggcgtac
ttggacggagcagatgtgggacactacagccctccgccgtcgtatcgcacgtctcctcct
tcctatcacacgcctccaccgagctacagcagccacagcttcgcccagcaaacccagatc
accatgcagtccacagtgcagctcaggacagaatacgacccccgcacgcaggctttctac
accacggccgagccccggtcgcagatctcggtgcagccgatcaacccggttcagacgagg
ggcaaccacagtggtgactactacaacaacaacaacaacgtcagcagaagcagcatgaac
agccgaggcagcaacctcggcaacaaccacggtgggagcagaggtaatgggggctcctca
ggctctgtggccttcactcatcactgcccagcgcccacatccggcacctgcaccgttcct
cagggtgactcagcctctacgaccagccatagcccagagaacaacagctccacgcgggac
ctgctgtctcagatcggagaggcctcaatgggtctgcactgcctcgagccctcctgctcc
cgctggaccttggcctcttttgctgagaagcactatgcgccgttccttctgcgacccacc
accaaggtggtcgtgattatgctattcctgggcctgctgggaatcagtctatatgggacc
acccaggtgcgtgacggcctggagctgacggacatagtgcccagagagaccagcgagtac
gacttcatcggtgctcagttcaagttcttctcattctacaacatgtacgtggtgactcag
cgggccaagtacgcccagagccaaccgctcttgcaccagctccaccagaggttccacacc
attcgctacgtgttgaaggaggacaacggccagcttccccgcatgtggctccacttcttc
agggactggctgcaaggactccagcaggcatttgacaaagactgggaggccggccacatc
accgtcaacagctacaagaatggttctgatgatggcgtcttggcttacaaactgttggtg
cagacgggacgcagggacaaacccatcaacttcagccagctgactcgacagagactcgtg
gatgcagatgggatcatcaatcctggggctttttacatctacctaaccgcctgggtcagc
aatgatcctgtcgcttatgctgcctcacaagcaaacatccgtccacaccctcccgagtgg
ctccacgaccggactgactccatgcccgagacacgtctcagcattcctgctgccgagccc
atcgaatatgcacagttccccttctacctcaacgggctccgagagaccccgcagtttgtg
gaggccatcgagagcgtgcgagcaatctgcaacaactacagccaacaaggcctgccctcc
taccccaacggctacccttttctcttctgggagcagtacatcagtctgcggcactggctt
ctcctttccatcagtgttgtgcttgcctgcacctttctagtctgtgccctgtttctgctc
aacccgtggaccgctggcatcatagtgcttgtgctctctctcatgactgtggagcttttt
ggcttcatgggactgatggcaatcaagctgagcgccgtccctgtggtcattctcattgcc
tcggtgggcattggagtggagtttacggtccatgtagctctggcattcctgacagctata
ggggatcgtcacaaacgggcagtgctggcactagagcacatgtttgctccggtgctggat
ggcgccttctccactttactgggtgtcttaatgctcgcaggctctgagttcgactttatc
gtcaggtatttctttgcagtgttagccatcctgacagttcttggagtcctgaatggattg
gtccttctcccagtattattgtcatactttggaccttatccagaggtttcacccactgat
gaccgaagtcggttacccactccctgcccagagtcccctcctcgagtggtccatttctcg
gtccgtccacaccaaacttctggacctgtcacgaactctggtgcagccacagactcgtca
gactcagagtacagctctaatgccacagtgtctggaataagccaagaggtacagaactac
aacctttaccctcacagaggacaaactcaaccagaggagcagcaccaccacctccggacc
agcaggggcagagtggcccggccagaggaggaaagaagagtggggtcaggacaacggcat
tcaccgagacaacagcctgaccccccagcctatactgtgtcttcgtttgttccttctcag
ggttgtgactctggtctccagcatggcaatactcagcgaaactgcagcagggaccccagg
ggccagcagcactggcaggcctcgcccccggcccaaccgcgcatggacgcttttgaaact
gcaactgaggctgggggccatcacacctctcgcagttacagagaacactcagcaggccac
agcaaccattcttcccacaactcacagcctcatcatcaccaacagcatcatcaccacctc
ccgcaccaacacaccaacaacgctcctttttgtcagcccatcaccacagtaacggcatca
gcctcggtcactgtggccgttcaccctgtgccattttccacccaaggtccagcttcctcc
tttccagaatacacgggaacagacagttactacccatcggggccagaggagtcagaatcg
gctttccaagacccccacgtgcctttgtacacccacacagggggtagggaggctaaggtg
gaatctgtggagcttcaggatttggaattagaggcagctgacacgaaccatggccaacag
gctagctga

DBGET integrated database retrieval system