KEGG   Xiphophorus couchianus (Monterrey platyfish): 114148522
Entry
114148522         CDS       T05908                                 

Gene name
gpr161
Definition
(RefSeq) G-protein coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114148522 (gpr161)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xco04030]
    114148522 (gpr161)
G protein-coupled receptors [BR:xco04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    114148522 (gpr161)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 114148522
NCBI-ProteinID: XP_027879681
LinkDB
Position
7
AA seq 523 aa
MNASRNCTSVGNGDGLAVLESVSILTITLLACLGNLLIVATLYRRPYLLTPSNKFVFSLT
LSNLLLSVLVLPFVAVSSAKREWVFGVVWCNFTALLYLLISSASMLTLGAIAIDRYYAVL
YPMIYPMKITGNRAVVVIVYVWLHSLVGCLPPLFGWSSFEFDCLKRTCVAAWSREPSYAA
FWVTWCILPPFFIMLACYGVIFRVARMKARKIHCGTVIVAQDDSSGTQRNGRKNSSTSTS
SNGSRRSLVYAGSQCKAFVTILVVIGTFLITWGPYVGVVCTEALWGQGNVSQELETLVAW
LSFCSAVCHPLIYGLWNKTVRKELLGMCFGDRYYRESFATRQRTSRLFSISNRITDLGMS
PHLTAMLAGGGHLLAQGSSTGDTGFSFTQDSGTDVMLLENSCTDGSSFPSQNGNPSGKRR
SSVTFEDQVEHSKAENTSSAQVHAETHKSLDSFASCLAKAIESDAKLTLFEQSLAPQGGG
LFVTRGAQKPRYPDGQRLRLESIDEGIVKDDREEEEEEKEKLI
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgaacgccagtaggaactgcacctcagtggggaacggcgatggtctggcagtcctggag
tcggtgtccatcttgaccatcacgctactggcctgcctggggaacctgctgatcgtggcc
accctctaccgcaggccgtacctgctcacgcccagcaacaagttcgtgttcagcctgacc
ctgtccaacctgctgctgtccgtgctggtgctgccgtttgtggcagtgagttcagcgaag
cgagagtgggtcttcggggtggtgtggtgcaatttcaccgcgctgctctacctgctcatc
agctcggccagcatgctgaccctcggagcgatcgccatcgacaggtactacgccgtgctc
tacccgatgatctaccccatgaagatcacaggcaacagggcggtggtcgtcatcgtctac
gtgtggctacactcgctggtgggctgcctgcccccgttgtttggctggtcctccttcgag
tttgactgtttaaagcggacatgtgtcgcagcctggtccagagagccgagttacgccgcc
ttctgggtcacctggtgcatcctcccgcccttcttcatcatgttggcctgctatggagtc
attttccgcgttgctcgcatgaaagccagaaaaattcactgtgggacggttattgtagcc
caagacgactcatctggaactcagagaaacggacgcaagaactcaagcacttcaacttcc
tctaacgggagcagacggagccttgtgtacgcagggagtcagtgcaaggccttcgtcacc
atcttggtggtgatcggcacctttctcataacttgggggccgtacgttggggtggtgtgt
acagaggccctgtggggtcagggcaacgtctctcaggagctggagactctggtggcgtgg
ctctctttctgcagcgccgtgtgccacccgctcatttatggcctgtggaataaaacggtg
aggaaggagctgctggggatgtgctttggcgatcgttactacagagagtcatttgccaca
aggcagcggacgtcccgactcttcagcatctctaacaggatcacagacttgggtatgtcc
ccgcacctgactgcaatgctggccggaggaggacacctgttggcccaaggaagcagcaca
ggagacaccggcttcagcttcactcaggactcaggcaccgacgtgatgctgctggagaac
tcctgcacagacggctcctccttcccctcacaaaacgggaatccatccgggaagaggcgg
agttcggtcaccttcgaagaccaggtggagcattccaaagctgaaaacacgtcttcggcc
caagtccacgcagagactcacaaatctctcgactcgttcgcttcctgcttggcgaaggcc
atcgagagcgacgccaagctcacgctgttcgagcagagtctagcgccgcaggggggaggg
ctctttgtgacgaggggggcgcagaagccccgatacccggacggtcagagactgaggctg
gagagcatcgatgaaggcatcgtcaaggacgacagagaagaggaggaggaggagaaggag
aagctcatctag

DBGET integrated database retrieval system