KEGG   Xiphophorus couchianus (Monterrey platyfish): 114150251
Entry
114150251         CDS       T05908                                 

Gene name
grk3
Definition
(RefSeq) beta-adrenergic receptor kinase 2
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114150251 (grk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114150251 (grk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114150251 (grk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114150251 (grk3)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     114150251 (grk3)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   114150251 (grk3)
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114150251 (grk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 114150251
NCBI-ProteinID: XP_027882398
LinkDB
Position
8
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKSTPAARASKKIILPEPSIRSVMQKYLEERDELTFDKIFN
QKIGFLLFKDFCMNEIDEAVPQLKFYEEIKEYEKLDSEEERLSRSRQIYDVYIMKELLSC
SHPFSKKAVDHVQSHLAKKLVPPTLFQPYIVEICDSLRGNIFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMNVELPDSFTPE
LKDLLEGLLQRDVSKRLGCQGRGALEVKEHQFFKGIDWQQVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYKNFPLVISERWQQEVAETVYEAVNLDTDKIEVRK
RAKNKQLGHEEDYAFGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRVEWRGEGESRQSL
LTMEQIVSVEETQVKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELNEAFTEAQKLLRR
APKVIGKGRAAVVELSKPPLTHRNSNGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctcgaagcggtactcgccgatgtcagctatttgatggcgatggagaagagc
aagtctactcctgccgcccgtgccagtaagaaaatcatcctccctgagcccagtattcgc
agtgtaatgcagaagtacctggaggaaagggacgaactcacttttgacaaaattttcaac
cagaaaattggattcctgctgtttaaagatttctgtatgaacgagatcgacgaggctgtg
cctcagctcaagttctacgaagaaatcaaggagtacgagaagctggactctgaggaggag
cgtctgagccgcagccggcagatttatgacgtctacatcatgaaggagctgctgtcctgt
tcacatccattttccaagaaggcagtggaccatgtgcagagtcatctggcaaagaaattg
gtcccaccaactctcttccagccatacatagtggagatctgcgacagcttgagagggaac
atcttccagaagttcattgaaagtgacaagttcactcggttttgccagtggaagaacgtg
gaactcaacatccatctgaccatgaacgacttcagcgtgcatcggatcatcggccggggc
ggcttcggggaggtgtacggctgcagaaaggccgacacggggaagatgtacgccatgaag
tgcttggacaagaagaggatcaaaatgaagcagggcgagactctggcgctcaacgagaga
atcatgctgtcgctagtcagcacaggggactgcccattcatcgtgtgtatgacgtacgcc
ttccacacccccgacaagctctgcttcatcctggacctcatgaacgggggcgacctgcac
taccacctctcccagcacggtgtgtttagtgagaaagagatgcggttctacgctgctgaa
atcatcctgggcctggagcacatgcacaaccgcttcgtcgtctacagagacctcaagccg
gccaacatccttttggacgaacacggccacgttcggatctcagacctcggcctggcctgc
gacttctccaagaagaagccccacgctagcgttgggactcatggctacatggctccagag
gtccttcagaagggaacggcgtacgacagcagcgcagactggttctctttaggctgcatg
ctcttcaaactcctcagagggcacagccccttcagacagcacaagaccaaagataaacat
gagatagaccgcatgacgctgaccatgaatgtggagctcccagattcgttcaccccagag
ctcaaggatctgctggaggggttgctccaaagagacgtgtccaagcggctcggttgccag
ggccggggagcgctagaggtgaaggagcatcagtttttcaaaggtatcgactggcagcag
gtgtacctgcagaagtacccccctcctttaatcccgcccagaggagaggtgaatgccgcg
gacgcttttgacatcggctcatttgatgaggaggacaccaagggcatcaagctgctggac
agcgaccaggagctgtacaagaacttccctctggtcatatcggagcgctggcagcaggag
gtggctgagactgtgtacgaggccgtcaacctggacacggacaagatagaggttcgcaag
agggccaagaacaagcagctgggccacgaggaggactatgcttttgggaaggactgcata
atgcacggctacatgctgaagctgggcaaccctttcctcacccagtggcagcgccgctac
ttctacctgttccccaaccgggtggagtggaggggagagggcgagtcgcggcaaagcctg
ctgaccatggagcagattgtgtcggtggaagagacgcaggttaaagacaagaagtgcatc
ctgctgcgcatcaaaggagggaagcagttcgtcctgcagtgtgagagtgacccagagttt
gtgcagtggaagaaggagctgaacgaggcattcacagaggcccagaagctgctgcgccgc
gcgcccaaggtgatcgggaaaggccgagccgccgtggtggagctctccaaaccgccgctc
acacaccgcaacagcaacggcctgtga

DBGET integrated database retrieval system