KEGG   Xiphophorus couchianus (Monterrey platyfish): 114151105
Entry
114151105         CDS       T05908                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04020  Calcium signaling pathway
xco04144  Endocytosis
xco04510  Focal adhesion
xco04540  Gap junction
xco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114151105 (pdgfra)
   04020 Calcium signaling pathway
    114151105 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114151105 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114151105 (pdgfra)
   04540 Gap junction
    114151105 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114151105 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114151105 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:xco04090]
    114151105 (pdgfra)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     114151105 (pdgfra)
Protein kinases [BR:xco01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   114151105 (pdgfra)
CD molecules [BR:xco04090]
 Proteins
  114151105 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set C2-set_2 Herpes_gE
Other DBs
NCBI-GeneID: 114151105
NCBI-ProteinID: XP_027883824
LinkDB
Position
9
AA seq 1457 aa
MDSVRMYLVCGVAIVLMVSVTPGLSAPTIWPAGDELVLEPHSIINVSCTGQSEVVWEEPP
ADDAVVTSNGFTSALLIYDATVEHTGYYGCRHKDKEGDQNDLVEIYVLVKDPQVVFVPER
AEELLVPYEVDLIIPCRVTAKTHDVELIRVPGGEKLHRYYDYRVGFMGDLSPGQYRCEAT
FKGQTFQSDIYTVMSLGSTEVSDFQVEVKASAETVRVGEPFNVSCIGPSGPAFHQQWIHL
KTQAVNAIQTTESLPDWVIYTLSVPRAAAQDGGRYECSVRHEASGKTRVSSVAVSVFGGN
SFVTLDHRGILKMESVGILAETQYTIYINAYPAPKVSWMKDDQALSENYYISSKTSHMEG
NRYQSIVTFRQPMEKDSGNYTITAISGSRTAQFSFILQVAGSTRLNLRPSFPPILLPDED
EIVVPLHEPFTLTCRGGAKLMWETPYDMLEESQEDNSGLFVTTIAVDEATAMHTGYYVCL
YNDHTAEETKTSSIYVYVSDPDSLFVPNFINHVPVDQNEIEIPCRVSDPSAIVTLVNVDT
NQTIPSDYDSKKGALGIFPTGTYVCKAIINGKEHTSEQYIVHDSIDVLHVELSAKRTALL
VGDTITVNCLAQGPYLLEDNWKYPGKPANRGTKTVRENKNEGQILYTLTIPQASTKDSGI
YSCSITAVASRDTQTKEIAIQVFAGEFLSIKPEFRDHESAELDDVREFIATISSFPDAHV
TWLKDGVPLSDLIAEISTSLKQTSETSYRSILTLIRVREEDSGNYTLRVENGNQSHEISL
NLVVKVPAVIVDLMDIHHGSATGQSAVCITRGQPTPVVEWFICKNIKQCANDSSFWAPLP
TNSTEITMESHFDEESNLESQVMFGHLKSTLAVRCLAKNEIGAVSREIKLVSNGPHPELT
VAAAVLVLLVIIIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSRW
EFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELK
IMTHLGPHLNIVNLLGACTKSGPIYIITEYCFHGDLVNYLHKNRESFLSPSPEKNKKELD
IFGINTADENSRSYVILSFECKGDYMDMKQADNTQYVPMLEISTTSKYSDVQGSDYDHPP
SQKDSGESDNLLSDDMSEGLTTTDLLSFTYQVAKGMEFLASKNCVHRDLAARNVLLSQGK
IVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTSLSDVWSYGILLWEIFT
LGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPQDVYEMMMKCWNTEPEKRPSFMGLSENV
ASLLPSSYKRHYEKVNHDFLKSDHPAVTRVCIETDADYVDIPYKNQGKLKDRESGFDEQR
LSSDSGYIIPLPDLDPISDDDYGKRNRHSSQTSEESAIETGSSSSTYAKREGETLEDITL
LDEMCLDCSDLAEDSFL
NT seq 4374 nt   +upstreamnt  +downstreamnt
atggacagcgtgaggatgtacctggtctgtggcgttgccattgtgttgatggtttcagtt
acgcctggactgtccgcccccaccatttggccagcaggagacgagctggtgctggagccc
cactccatcatcaacgtcagctgtacgggccaatcagaagtggtctgggaagaacctccg
gcggacgacgccgtcgttacttcaaacggtttcacctcagctctcctcatttacgacgcg
acggtcgagcacaccggctattacgggtgcaggcataaagacaaggagggcgaccaaaac
gatctggtggaaatctatgtcctagtcaaagatcctcaggtcgtgtttgtcccagagaga
gcagaggagctgctcgttccctacgaggttgatttgatcatcccatgccgagtgacggca
aagacccacgacgtggaactaatccgagtccccggcggagagaagctccacaggtactac
gactacagagtgggcttcatgggcgacctctctcctggccagtacaggtgtgaggccaca
tttaaaggccagactttccaaagtgacatctacaccgtaatgagtttgggatccacggag
gtgagcgactttcaggtggaagtcaaagccagcgcggagacggtgcgagtcggggagccc
tttaacgtctcctgcatcggaccctctggcccagccttccaccagcagtggatccatctg
aaaacacaggctgtaaatgcgattcagacgacggaaagtcttcctgactgggttatctac
actctgagcgtcccgcgagccgccgctcaggacggcggccgctacgaatgctcggtcagg
cacgaggccagtggaaaaaccagggtgagcagcgtggctgtgtctgtgtttgggggaaac
tcctttgtcaccctggaccacagagggattctgaagatggagtccgttggcattctggca
gagacgcagtacaccatctacattaatgcatacccggctccgaaagtgtcatggatgaaa
gacgaccaagcgctgtcggagaactactacatttcttccaaaactagccacatggaagga
aatcggtatcagagcattgttacgttccggcagcctatggagaaagacagcggaaattac
acaatcacagccataagcggctctcgcaccgcccagttctcatttatcctccaagtggca
ggttccactagacttaacctcagaccgtccttcccccctatcctgctaccggacgaggat
gagattgtcgtccctctccacgagccgttcacgctgacatgtcgcggaggtgcgaagctg
atgtgggaaacaccgtacgacatgctggaggaatcgcaggaggacaacagtggccttttc
gtcaccaccatcgctgttgacgaagccacagcgatgcacacaggttattacgtttgcctc
tacaatgaccacactgcagaggaaaccaagaccagcagtatttacgtctatgtgtcagat
cccgactctttgttcgtgccaaatttcattaaccatgtgccggttgaccaaaatgagatc
gagattccctgcagggtgtctgatccaagtgctattgtgacactggtgaatgttgacacc
aaccaaaccatacctagtgattatgacagtaaaaagggtgctttgggaatatttcctact
ggaacgtatgtctgcaaggccatcatcaacggaaaggagcacaccagtgagcaatacatc
gtccatgattccatagatgtcttgcacgtcgagctgtctgccaaaagaactgccttgctg
gttggagacacaataactgtcaactgcctggctcaaggaccttatttactggaagacaac
tggaaataccctggcaaaccggctaatcggggtaccaaaactgtacgggaaaataagaat
gaaggccagatcctgtacaccttgacaatcccacaagcctcaaccaaagacagcggcatc
tactcctgctccattaccgctgtagcgtctagagacacccagacaaaggaaatagctatt
caagtgtttgccggtgagtttttgtccatcaagccggagtttcgggaccacgaatctgct
gagctggatgacgtccgggagttcattgccacaatttcctcctttcctgatgcccatgtt
acttggctcaaggacggcgtcccgctcagcgacctgatcgctgagatctccaccagtttg
aagcagaccagtgagaccagctacagaagtattctcaccctgatccgggtcagggaggag
gacagtgggaactacaccctgcgggtggagaacggaaaccagagccatgaaatcagctta
aacctggtggttaaagtgcctgcagtcatcgtggacctcatggacattcaccatggttcc
gccacaggacagtctgcagtgtgcattaccagggggcagcctactcctgttgtggagtgg
ttcatatgcaagaacatcaaacaatgcgccaatgactcgtctttttgggcgcctctaccc
accaactcaacagaaatcacgatggagtcccacttcgatgaggagagcaacctggagagt
caggtcatgtttggccatctgaaaagcactctggctgtgcgatgccttgccaagaatgaa
ataggagctgtcagcagggagatcaaattggtgtccaatggccctcaccctgagctgacg
gtagctgctgctgtgctggtgctcctggtcattatcatcatctcactcattgtcttggtt
gttatctggaagcagaaaccacggtacgagatccgctggagggtcatagagtctgtgagt
ccagacggtcatgagtacatctatgtggatcccatgcagcttccctacgactccagatgg
gagtttccccgagatagacttgtgcttggccggatcctgggctctggagccttcgggaag
gtggttgagggcactgcctacggactcagtcgctctcagcctgttatgaaggtggcagtg
aaaatgctgaaacccacggctcgctccagtgagaagcaggctctgatgtctgagctgaag
atcatgactcacctcggacctcatctcaacatcgtgaacctcctgggagcgtgcaccaag
tcaggccctatctacattatcaccgagtactgcttccacggcgacctggtgaactatctg
cacaagaacagggagagcttcctcagcccgagtccagagaaaaacaagaaggagctggat
atctttgggatcaatactgcggacgagaacagcaggagttacgtgatcctgtccttcgag
tgtaaaggagactacatggacatgaagcaggcggacaacacccagtatgtgcccatgctg
gagataagcacgacctccaagtactctgacgtacagggatccgactacgaccaccctcct
tcacagaaagactcaggcgaatccgacaacctgctgtcagacgacatgagcgaaggcctc
acgaccaccgacctgctcagcttcacctaccaggtggccaaaggaatggagtttcttgcg
tccaaaaattgcgtgcatcgggaccttgcagccaggaatgtccttctctctcagggcaag
attgttaagatctgtgactttgggctggccagagacatcatgcatgacaacaactatgtc
tccaaaggaagcacctttttgccagtgaagtggatggccccggaaagtatttttgacaac
ctgtacaccagtcttagtgacgtttggtcatatggcatcctcctctgggaaatattcacc
ctaggtggcactccgtacccagggatggtggtggattccagcttctacaacaaaatcaag
agcggatacaggatgtcaaaacctgagcacgcgccgcaagatgtgtacgagatgatgatg
aagtgctggaacacagagccggagaagaggccttccttcatgggtctgagtgaaaatgtg
gcgtctttgctgccctccagctacaagaggcactatgagaaggtgaaccacgattttcta
aagagtgaccatcccgccgttactcgagtctgcatcgagacggacgcggactacgtcgac
attccctacaagaaccagggcaagctaaaggacagggaaagcggcttcgacgagcagcgg
ctgagctccgacagcggctacatcatcccactccctgacctggaccctatatctgatgat
gactacggaaagaggaacagacacagctctcaaacgtctgaggagagcgccattgagact
ggctccagtagctccacctacgccaagcgcgagggcgagaccctggaggatatcacgctg
ttggacgagatgtgtctggactgcagcgacctggccgaggacagctttctgtga

DBGET integrated database retrieval system