KEGG   Xiphophorus couchianus (Monterrey platyfish): 114152492Help
Entry
114152492         CDS       T05908                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00010  Glycolysis / Gluconeogenesis
xco00053  Ascorbate and aldarate metabolism
xco00071  Fatty acid degradation
xco00280  Valine, leucine and isoleucine degradation
xco00310  Lysine degradation
xco00330  Arginine and proline metabolism
xco00340  Histidine metabolism
xco00380  Tryptophan metabolism
xco00410  beta-Alanine metabolism
xco00561  Glycerolipid metabolism
xco00620  Pyruvate metabolism
xco01100  Metabolic pathways
Module
xco_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    114152492 (aldh2)
   00053 Ascorbate and aldarate metabolism
    114152492 (aldh2)
   00620 Pyruvate metabolism
    114152492 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    114152492 (aldh2)
   00561 Glycerolipid metabolism
    114152492 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    114152492 (aldh2)
   00310 Lysine degradation
    114152492 (aldh2)
   00330 Arginine and proline metabolism
    114152492 (aldh2)
   00340 Histidine metabolism
    114152492 (aldh2)
   00380 Tryptophan metabolism
    114152492 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    114152492 (aldh2)
Enzymes [BR:xco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     114152492 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 114152492
NCBI-ProteinID: XP_027886207
LinkDB All DBs
Position
11
AA seq 517 aa AA seqDB search
MLRTVLSRGITSLIRPSVSYYGTAVPVPSAQPEVHFNKLFINNEWQEAVSGKTFPTINPS
TEEIICQVAEADKADVDKAVKAARNAFRLGSPWRRMDASDRGRLLYKLADAIERDSAYLA
ELETLDNGKPYVISYMADLPLVVKCLRYYAGWADKWEGKTIPVDGDYFTYTRHEPVGVCG
QLIPWNFPLVMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPEGVVNILPG
MGPTAGAAIANHMDVDKVAFTGSTEVGHLIQQAAGNSNLKKVTLELGGKSPNIILSDANL
ENAVEQSHIGLFFNQGQCCCAGSRVFVQSDVYDEFVERSVARAERRVVGDPFDFKTEQGP
QVDQEQFKKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDNMIIAREEIFGP
VMQIFKFKTLEEVITRANDTKYGLAASVFTTDIDKANYVSSGLRAGTVWINCYNVFASQA
PFGGYKASGNGRELGEYGLEAYTEVKTVTIKVPQKTS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcacagtgctttcccggggtattactagcctgatccgaccctcagtctcctac
tatgggaccgctgttccggttccgagcgctcagcctgaggtccatttcaacaagctgttt
attaacaatgaatggcaggaagctgtgagtgggaaaacctttcctacgatcaatccatcc
actgaagaaatcatctgccaggttgcagaggctgataaggcagatgtagataaggcagtg
aaggccgcacgtaacgcctttaggctgggctcaccttggcgccgtatggatgcatctgat
cggggcagacttctttacaaattagccgacgctattgaaagagattctgcctacctcgct
gaactggagaccttggacaacgggaagccgtatgtcatttcctatatggctgatttaccc
ttggttgtgaaatgtctcaggtactatgcaggttgggcagacaagtgggaggggaagacc
atccctgttgatggagattacttcacatataccagacatgaacctgttggagtctgtgga
cagctaataccttggaacttccctctggtgatgcaggcctggaaacttgggccagcctta
gcaactggtaatactgtcgtgatgaaagtagctgagcaaacaccactcacagcactctat
gtggccagtctcattaaagaggttggatttcctgaaggcgtggtcaatatcttgcctgga
atgggaccgacagctggtgcagccattgccaaccacatggatgttgacaaggtggccttt
actgggtccacagaggtgggtcatctgatccaacaggcagcaggcaacagtaacctgaag
aaagtcacattagaactgggaggaaagagtccaaatatcattctgtctgatgccaacttg
gaaaatgctgtggagcagtcccacattggcctgtttttcaatcaaggccagtgttgctgt
gctggctctcgagttttcgtccaatcagatgtctacgatgagtttgtggagcgcagtgtg
gcacgtgctgaaagaagagtggtgggagacccgtttgacttcaagactgagcagggccct
caggtagatcaggagcagttcaaaaagattctgggctacatcagcagtgggaagagagaa
ggtgccaaactgatgtgtggaggaggagtggcagcagacagaggctacttcatccagcct
acggtgtttggagatgtccaggacaacatgatcattgccagggaggagatttttggtcca
gtgatgcagatctttaaatttaaaacactggaggaggttataaccagagccaacgacacc
aaatatggacttgcagcttcagttttcacaactgacattgacaaagcgaactatgtttcc
agtgggctccgggctggcacagtctggataaactgttacaacgtgtttgcttcccaggct
ccatttggaggctacaaagcctcaggtaatggcagagagttgggagagtatggactggaa
gcctacacagaagttaaaacggtgacaatcaaggtgccacagaagacttcttaa

DBGET integrated database retrieval system