KEGG   Xiphophorus couchianus (Monterrey platyfish): 114152626
Entry
114152626         CDS       T05908                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114152626 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114152626 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xco04052]
    114152626 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:xco00536]
    114152626 (fgf1)
Cytokines and growth factors [BR:xco04052]
 Growth factors
  Growth factors (RTK binding)
   114152626 (fgf1)
Glycosaminoglycan binding proteins [BR:xco00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   114152626 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 114152626
NCBI-ProteinID: XP_027886364
LinkDB
Position
11
AA seq 167 aa
MGGLSSCFRSAPPRPEQSGGEHIAQPPSLQQTQDLSFLPERRSRVKLYCQTGGYHLKIAE
DGTVSGVREEDDPYVIMKLKSVGVGLIVIQGVQSLKYLAMNQKGDLFGKDSPTDDCNFLE
HIEPNGYTTLRHEEYSWYVGMKANGTPMKGTETHQGMKNILFLPRPA
NT seq 504 nt   +upstreamnt  +downstreamnt
atggggggcctctcttcttgtttccggagcgctcctccacgtcccgagcagagtggtggg
gagcatattgctcaacctccgtctttacaacagacccaggatcttagcttccttccggag
agacgctcgagagtcaagctctactgtcagactggaggatatcacctgaagattgctgaa
gatggaacagtgtctggtgtgagggaagaagatgatccctatgtaatcatgaagctgaag
tcggtgggtgtaggacttattgtcatccagggggtgcagtcattaaagtacctggctatg
aaccagaaaggagacctcttcggaaaagatagcccgactgatgactgtaacttcttggaa
catattgaaccaaacggctacaccacacttcgccacgaggaatactcctggtatgttggt
atgaaggcgaatggcacacctatgaagggaacagaaacccaccagggcatgaagaacatt
ttattcctgccgagaccagcctaa

DBGET integrated database retrieval system