KEGG   Xiphophorus couchianus (Monterrey platyfish): 114152719
Entry
114152719         CDS       T05908                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00230  Purine metabolism
xco01100  Metabolic pathways
xco04020  Calcium signaling pathway
xco04114  Oocyte meiosis
xco04261  Adrenergic signaling in cardiomyocytes
xco04270  Vascular smooth muscle contraction
xco04371  Apelin signaling pathway
xco04540  Gap junction
xco04912  GnRH signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114152719 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    114152719 (adcy3)
   04020 Calcium signaling pathway
    114152719 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    114152719 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114152719 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114152719 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    114152719 (adcy3)
   04916 Melanogenesis
    114152719 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114152719 (adcy3)
   04270 Vascular smooth muscle contraction
    114152719 (adcy3)
Enzymes [BR:xco01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     114152719 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4 DUF1053
Other DBs
NCBI-GeneID: 114152719
NCBI-ProteinID: XP_027886471
LinkDB
Position
11
AA seq 1121 aa
MPRNQAFSEPEYSVEYSADCSVTLPSDPGQAVGRTHEVTVRNSGSCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYILIMCAVVYTSEKLASVSVATVGLAGDIL
LYLLCRFGLLPDRISRRFVPYSLWVLIALQIFCHLGLNYARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITTVSCGVHTLVLGVTIAQQQQENIQGSALARQLLANIVIYICAITVG
VTSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPEYRGDHAACSIRMGLAMVDAISYVREKTQTNVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGDRCD
YLRERGIETYLVTVPKDPLGRNGISPVKLSVTSSNGNSPLLINTTECNGSVEAACNTPEE
PEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALKGKH
TNRLSLRFVDPDLEVRYSIEKEKQSGAAFCCSCVVLLFTSVMEALIDPRLIINYITFAVG
EILLFILTICSLAAIFPGVFPKKLVSFSIWIDHTRWARNMWAIAAIFILTMADLLDMLSC
TPGVPDSSSTTAAPFSSSSSQSILGGCLNNPKYYSFTAVLALIATTMLVQVSHMVKLTLM
LLITATTGIVNIYSWKDIFDHYDMVRFQEYSSEMVPSKFTMTVMIFIMMVSFYYFSRHVE
KLARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDE
IGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPKFRYITKIKTIGSTY
MAASGVTSDVNDGYKCMKKEEQSDRERWQHLADLADFALAMKVTLMNINYQSFNNFMLRI
GLNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGFRFVR
RGPIFVKGKGELLTYFLKGRDKQGSFINGSSVTLPHQVVDS
NT seq 3366 nt   +upstreamnt  +downstreamnt
atgcctcgcaatcaagctttttctgaaccagagtactctgtggagtattcggcagactgc
tctgtgacattgccctctgatccggggcaggctgttggacgaacacacgaggttacagtt
cgaaattctggatcctgcctttgcctgccacggtttatgcgcctgacatttgcaccagag
tcgttggagaatctctaccagacctacttcagaaggcagagacatgaaacacttttggtg
ctggttgtgtttgctgctctttttgatagttacatcctcatcatgtgtgcagtggtttat
acctctgaaaaacttgcatccgtctctgtggcaactgtgggattggcaggagatattctt
ctctacctgctgtgccgctttgggttgttaccagaccggatctcaaggcgttttgtgccc
tattccctctgggtccttatcgcattacagatattttgccacttgggtctaaactatgct
cgtttccaccaggctagtgacacagtgggttggcaggccttcttcagcttttcttttttc
cttactctgcctttgagactaacacccattgtgctcatcactactgtatcctgtggggtt
cacaccctggttcttggagtcaccattgctcagcagcagcaggagaacatccagggctca
gcgcttgccagacagctactggccaacattgtgatctatatttgtgccatcaccgtgggt
gtcacatcgtactacatggctgaccggaagcatcgaaaggcttttctggaagcaagacag
tcactggaggttaaacttaacctagaagagcaaagccagcaacaggaacgtctcctgctc
tccattcttcccaagcatatagctgatgagatgcttcaggatatgaagaaggagcccagt
caaaaagagatgcaacagttcaacaccatgtacatgtacaggcatgaaaatgtcagtatt
ctgtttgcagacattgtgggtttcacccagctgtcgtcatcttgcagtgcccaggagctg
gtgaagctgctcaatgagctttttgctcgctttgacaagctggctgctaaatatcatcaa
ttgaggatcaagatcttgggagactgttattactgcatctgtggacttccagaataccgg
ggagaccatgctgcctgttccatcaggatgggcctggctatggtggatgctatctcgtat
gtccgtgaaaaaacccaaaccaatgttgatatgagggttggagtgcacagtggaacagta
cttggaggagtgctgggacagaaacgctggcagtatgatgtttggtctacggatgtcaca
gtagccaacaaaatggaagcaggaggcattccaggacgtgttcacatctcacaaagtacc
atggagtgtctccatggagagttcgatgtggagccgggaaatggaggtgatcgctgtgac
tacctgagggagagaggtattgagacctacctggtgactgttcctaaagatcccctggga
agaaatggaatcagtcctgtgaagctgtcggtaacctcttctaatggaaattccccacta
ttaatcaacacaacagagtgtaacggcagcgtggaggcagcctgcaacacacctgaagaa
ccagaagagttggacacaagggtagtgaacccatcttttccaaatccacggaggaggcta
cgactgcgggacctggctgaacgggtgattgacgcccaagagaatgagcaagagctcaac
aagttgcttaatgaggctctgttggagagagaaacagttcaagctctgaagggaaaacac
accaacaggctttctttgaggtttgtggatccagacctagaggttcgttattccattgag
aaggagaagcagagcggtgctgccttctgttgctcctgtgttgttcttctctttacttca
gtaatggaggcactgatagaccccaggctcattataaactacatcacctttgcagtggga
gagattttgctgtttatcctgacaatctgctctcttgcagccatctttccaggagtcttt
cccaaaaagttggtgtctttctcaatctggattgaccacacccgttgggctcgaaatatg
tgggccattgcagctattttcatcttaaccatggcagaccttttagatatgctcagttgt
acacctggagtcccagattcaagtagcaccacagcggctccgttttcttcctcatcttca
cagtccatccttggaggatgcctgaataatcctaaatattacagcttcacagcagtgctt
gcactaatagccactaccatgctagttcaggtcagccacatggtcaagcttacattgatg
ctacttataacagcaacaactggcatcgttaacatctacagttggaaagacatctttgac
cactacgacatggtccgcttccaagaatacagctcagagatggttccctccaagttcact
atgacagttatgatcttcattatgatggtcagcttctattacttctccagacatgtggag
aagcttgctcgcacgcttttcttatggaagatagaagtccatgagcagaaggagaaagta
tatgaaatgaggcgctggaatgaagctctcgtaacaaacatgttacctgaacacgtggct
cgacacttcctgggttccaagaaaagggatgaggagttgtacagccagtcatacgatgag
attggtgtcatgtttgcctcaattcccaacttctctgacttttacacagaggagagcatc
aataatggtggcattgaatgtctacggttcctcaacgagatcatctcagattttgatagt
ctactggatgagcccaaatttcgctacatcacaaagatcaagaccattgggagcacatac
atggcagcatcaggtgtcacctctgatgtcaatgatggttacaagtgcatgaagaaggaa
gagcagtctgacagagagcggtggcagcacctggcagacttggcagactttgctctggcc
atgaaggtgacactaatgaacatcaactaccagtcattcaacaacttcatgctacgcatt
ggcctgaacaaaggaggagtgctagctggagtgatcggtgctcggaaaccccactatgac
atctggggaaacactgtgaatgtggccagtcggatggagtccacaggagtgatgggaaac
atccaggtagtggaggactgctataatattttgaaggagtatggattccgctttgtgaga
agaggacccatctttgtaaagggaaaaggagaactgctcacttattttctgaaaggaaga
gacaaacagggctcatttattaatggttcatccgtcactctaccacatcaagtagtagat
agttaa

DBGET integrated database retrieval system