KEGG   Xiphophorus couchianus (Monterrey platyfish): 114153400
Entry
114153400         CDS       T05908                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114153400 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xco03000]
    114153400 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:xco03310]
    114153400 (nr3c1)
Transcription factors [BR:xco03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    114153400 (nr3c1)
Nuclear receptors [BR:xco03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   114153400 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR
Other DBs
NCBI-GeneID: 114153400
NCBI-ProteinID: XP_027887738
LinkDB
Position
11
AA seq 765 aa
MDQGGPKHNGNRNDNLTFAGIRPEVGRDSVSTSGLLLQPTMHLPSPGSVNQSTVAPNGQG
GTKDQGELGGLFESDKEGKMSRMHKQEQDIFSYGDSLSLLNQSTSDLDQTSTSVINTSET
SVLGNLPLPDLFPQQIKQEGIFSLDKELGTYGGQAGVGSCSLDGSTSQLIDDADIWQDLD
LPNSLPEISAFELDSEVAHLDTILQESSSGGEKSLLGNGANCIGLNGTEQQQLVQQHQLQ
QQQPPGMLSSVVIKVEKDPDFIHIRTPGVVKQEKQDGASYCQSQCLQSGMNPLHGVGTIP
SAMGLATGTGYHYRGNPETAGLQDQKPFGTYSNLPGVGESWISGKRYGEASGIQSTSDGL
QSAAALGNFPVSFTSSPARTGENSSTAVTGQSKPGGQAHKICLVCSDEASGCHYGVVTCG
SCKVFFKRAVEGWRARQNTDGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEA
RKNKKLNKIKVQTPTRPSEPASSLPMPIIPRSMPQLVPTMLSVLKAIEPEIIYSGYDSTL
PDTSSRLMSTLNRLGGQQVISAVKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFSLGWRS
YEQCNGRMLCFAPDLVINEERMKLPLMGDQCEQMLKICNEFVRLQVSYDEYLCMKVLLLL
STVPKEGLKSQAVFDEIRMTYIKELGKAIVKREENTSQNWQRFYQLTKLLDSMQEMVEGL
LQICFYTFVNKTLSVEFPEMLTEIITNQIPKFKDGSVKPLLFHQK
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggatcagggtggaccaaagcacaacggtaatcggaacgacaaccttacatttgcaggg
atcagacctgaagtaggcagagattcagtcagcacatctggtttactgcttcaacccaca
atgcatctgcccagtcccgggtctgtgaaccagagcacagtggcaccgaatggacaaggg
ggaactaaagaccagggggaacttggaggcctctttgagtcagataaggagggtaaaatg
agcagaatgcacaaacaagaacaggatatattcagctatggggacagtttgtctttgttg
aaccagagtacttctgatctcgaccagacgtccacctctgtcattaacacatcagaaacc
tcagtcctggggaacctccctttgcctgacctgttccctcagcaaattaagcaggagggg
attttctctctggataaggaattaggaacttatggtggacaagcaggtgttggttcttgc
agtctggatgggagcacttctcagctaattgatgatgcagatatctggcaagacctggac
cttccgaactctctgccagaaatcagtgcttttgagttggattcagaggtggcacatttg
gataccatcctccaggagagcagcagcggtggtgaaaagtccctgttaggtaatggggcc
aactgtattggtttgaacggcacagagcagcagcagctggtacagcaacatcagcttcaa
cagcagcagccaccgggaatgctttccagtgttgtcatcaaggtggagaaggatcccgat
ttcatccacatccgtacccctggtgtggtcaaacaggagaagcaggacggtgctagttac
tgccagtcccagtgtctgcagagtggcatgaaccctctgcatggggtgggaaccataccg
tctgccatgggtcttgccacgggaactgggtaccactacagaggcaatcctgagacagcg
ggcttgcaagaccagaagccttttggcacatactcaaacttgccaggagtcggggagagc
tggataagcgggaagaggtatggagaagcctctgggattcagagcaccagtgatggcctt
caatctgctgcagctttggggaattttcctgtcagctttacaagctcaccagccagaaca
ggagagaacagcagcactgccgtgacaggccagtccaagcccggtgggcaagcccataag
atctgtctggtgtgctcggacgaggcatcaggatgccattacggggtggtgacctgtggc
agctgcaaagtgttcttcaaaagggccgttgaaggatggagagcacggcaaaacacagat
ggtcagcacaactatctgtgcgcgggaagaaatgactgcatcattgataagatccgcagg
aagaactgtccagcatgccgcttcaggaaatgtctccaggccggaatgaacctggaagca
aggaaaaacaagaagcttaacaagattaaagtgcaaacgccgaccaggccctccgaacct
gccagcagcctgcccatgcccatcatacccagaagcatgccgcagctcgtgcccaccatg
ctgtccgtcctgaaggccatcgagcctgagatcatctactcgggctacgacagcacgctg
ccggacacctcatctcgtctcatgagcaccctcaacagactgggaggccagcaggtcatc
tctgccgtcaaatgggccaagtcgctgccaggcttccgtaacctgcaccttgatgatcag
atgacgttgctgcagtgctcctggcttttcctcatgtccttcagcctcggctggaggtcc
tatgagcagtgtaacggcagaatgctctgtttcgctccagatctcgtcataaatgaagag
cgcatgaagctgcctttaatgggtgaccagtgtgagcagatgctgaagatttgcaatgag
tttgtccgactgcaggtgtcttatgatgagtatctctgcatgaaggtcctgctactgctg
agtacagttccaaaagaaggcctgaagagccaggcggtttttgatgagatcaggatgact
tacatcaaggagctgggaaaagccattgtgaagagagaggagaacacgagtcagaactgg
cagcggttctaccagctaactaagctactggactccatgcaggagatggtggagggtctc
ctgcagatctgtttctacacctttgtgaataagaccctcagcgtggaattcccagagatg
ctgacggagatcatcaccaaccagataccaaaattcaaagacgggagcgtcaaacctctg
ctgtttcatcagaagtga

DBGET integrated database retrieval system