KEGG   Xiphophorus couchianus (Monterrey platyfish): 114153593
Entry
114153593         CDS       T05908                                 

Gene name
arrb2
Definition
(RefSeq) beta-arrestin-2 isoform X1
  KO
K04439  beta-arrestin
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04144  Endocytosis
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114153593 (arrb2)
   04340 Hedgehog signaling pathway
    114153593 (arrb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114153593 (arrb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114153593 (arrb2)
Membrane trafficking [BR:xco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    114153593 (arrb2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C CBM_3
Other DBs
NCBI-GeneID: 114153593
NCBI-ProteinID: XP_027888052
LinkDB
Position
11
AA seq 407 aa
MGDKAGTRVFKKSSPNCKLTVYLGKRDFVDHLDHVDPVDGVILVDPEYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLYISTFQAFPPVPEEKKANSRLQERLLKKLGQHAHPFYFTI
PQSLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKIHKRNSVRLVIRKVQYAPEKPG
PQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYA
DICLFSTAQYKCPVAQLEADDQVSSSSTFCKVYTLTPTLDKNREKRGLALDGKLKHEDTN
LASSTIVKDVTNKEVLGILVSYRVKVKLVVSRGGDVSVELPFILMHPKPVEPPASRPQSA
VPDSDPPIDTNLIEFDTNSVSQDDDFVFEDFARLRLKGVVDDKDEDC
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgggggacaaggcgggcaccagagtcttcaagaagtccagtccgaactgcaagctcaca
gtctacttggggaagcgggactttgtggaccacctggaccacgtggacccagtggatgga
gtgatcctggtggacccggagtacctgaaggacaggaaagtcttcgtcacgctgacctgc
gccttccggtacggccgggaggacctggacgtcctgggcctgtccttcaggaaggacctg
tacatctccaccttccaggcattccctccagttcctgaagagaagaaagccaacagccgg
ctgcaggagcgtctactgaagaagctgggccagcacgcccatcctttctacttcacaatc
cctcagagcctgccgtgttcggtcaccctgcaacccggaccagaggacactgggaaggct
tgcggtgtggactttgagatcagagctttctgtgccaagtccatagaggagaagatccac
aagagaaactcggtgcgcctggtgatcaggaaggtccagtatgccccagagaagccgggc
cctcagcccatggtggagacgacccggagcttcctgatgtcagaccgctccctgcacctg
gaggcgtcgctggataaggagctgtactaccacggcgagcccatcagcgtgaacgttcac
gtcaccaacaactccaccaagacagtgaagagagtcaagatctcagttcgccaatacgcc
gacatctgcctgttcagcaccgcccagtataaatgcccagtggcccagctggaggcagat
gaccaggtgtcgtccagctccaccttctgtaaggtgtacactctgactccgacgctggat
aagaaccgggagaagagaggcctggctctggacgggaagctgaagcacgaagacaccaac
ctggcctcctccaccatagtgaaggacgtgaccaacaaggaggttctgggcatcctggtg
tcctacagggtcaaggtcaagttggtggtgtcacgtggaggggacgtgtcggttgagctg
cccttcatcttgatgcatcccaaacccgtggagccgcccgcgtcccgcccacagtcagcc
gtgccggactcggacccacccattgacaccaacctcatcgagtttgacaccaacagcgtc
tcccaggacgacgacttcgtctttgaggacttcgcccgcctgcgcctcaaaggcgtcgtg
gacgacaaggacgaggactgctag

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114161734
Entry
114161734         CDS       T05908                                 

Definition
(RefSeq) beta-arrestin-1
  KO
K04439  beta-arrestin
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04144  Endocytosis
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114161734
   04340 Hedgehog signaling pathway
    114161734
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114161734
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114161734
Membrane trafficking [BR:xco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    114161734
SSDB
Motif
Pfam: Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 114161734
NCBI-ProteinID: XP_027901084
LinkDB
Position
18
AA seq 417 aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHVDLVEPVDGVVLIDPEYLKERKVFVTLTCA
FRYGREDLDVLGLTFRKDLFVVNIQAFPPLPEEKKSLTRLQERLIKKLGEHAYPFTFEIP
LNLPCSVTLQPGPEDTGKACGVDFEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPEKPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKMKISVRQYAD
ICLFNTAQYKCPVAVEESDDVVAPSSTFCKVFTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVSVELPFTLMHPKPLEES
IYRDAPDEAPIDTNLIEFDTNDDDIIFEDFARQRLIGAKDEKEEEEEPLDSPKPDDR
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggagataaaggaaccagagtgtttaagaaggccagtcccaacgggaagctcacggtt
tacctggggaagagagactttgtggaccatgtggacctggtggagcccgtcgatggagtt
gtgttaattgacccagaatacctgaaggagaggaaagtgttcgtcacgctgacctgtgcc
ttccggtacggccgggaggacctggacgtcctggggctgacgttcaggaaggacctgttc
gtggtgaacatccaggcgtttcctccactgcctgaagagaagaagagtctgactcgtctt
caggaacgcctgattaaaaaactgggggagcacgcctaccccttcaccttcgagatccct
ctgaacctgccgtgctccgtcaccctgcagccgggaccggaggacaccgggaaggcgtgc
ggagtcgactttgaggtgaaagctttctgcgcagaaaatctagaggagaaaatccacaaa
aggaactcggtgcgcctggtcatcaggaaggttcagtacgccccggagaaaccgggcccc
cagccgacggccgagaccaccaggcagttcctgatgtcggacaaaccgctgcacctggag
gcgtcgctggacaaggagatttattaccacggcgagcccatcagtgtcaacgttcacgtc
accaacaacaccaacaagacggtgaagaagatgaagatctcagtgcggcagtacgcggac
atctgcctgttcaacacggcgcagtacaaatgtcccgtcgctgtggaagagtcggatgac
gttgtggctcccagctcaacgttctgcaaagttttcaccctcactccattcctggccaac
aaccgggaaaagcgcggcctcgccctggacggaaaactgaagcacgaagacaccaacctg
gcctccagcactctcctgagagaaggagccaacagggagatcctcggcatcatcgtgtcc
tacaaagtcaaagtgaagctggtggtgtcacgaggcgggcttctcggagatctggcttcc
agtgacgtctctgttgagctgcccttcacattaatgcacccgaagccgctggaggagtcc
atctaccgagacgctccagatgaagctccgatcgacactaacctgattgagtttgacaca
aatgacgatgacatcatattcgaggacttcgcccgccagcggctcattggcgctaaagac
gagaaggaggaagaggaggaaccgttggactcacccaaacccgacgacagatag

DBGET integrated database retrieval system