KEGG   Xiphophorus couchianus (Monterrey platyfish): 114154145
Entry
114154145         CDS       T05908                                 

Gene name
mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04114  Oocyte meiosis
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04261  Adrenergic signaling in cardiomyocytes
xco04270  Vascular smooth muscle contraction
xco04350  TGF-beta signaling pathway
xco04370  VEGF signaling pathway
xco04371  Apelin signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04540  Gap junction
xco04620  Toll-like receptor signaling pathway
xco04621  NOD-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04916  Melanogenesis
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114154145 (mapk1)
   04012 ErbB signaling pathway
    114154145 (mapk1)
   04350 TGF-beta signaling pathway
    114154145 (mapk1)
   04370 VEGF signaling pathway
    114154145 (mapk1)
   04371 Apelin signaling pathway
    114154145 (mapk1)
   04068 FoxO signaling pathway
    114154145 (mapk1)
   04150 mTOR signaling pathway
    114154145 (mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114154145 (mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    114154145 (mapk1)
   04210 Apoptosis
    114154145 (mapk1)
   04218 Cellular senescence
    114154145 (mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114154145 (mapk1)
   04520 Adherens junction
    114154145 (mapk1)
   04540 Gap junction
    114154145 (mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114154145 (mapk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114154145 (mapk1)
   04621 NOD-like receptor signaling pathway
    114154145 (mapk1)
   04625 C-type lectin receptor signaling pathway
    114154145 (mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114154145 (mapk1)
   04912 GnRH signaling pathway
    114154145 (mapk1)
   04914 Progesterone-mediated oocyte maturation
    114154145 (mapk1)
   04916 Melanogenesis
    114154145 (mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114154145 (mapk1)
   04270 Vascular smooth muscle contraction
    114154145 (mapk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114154145 (mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114154145 (mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xco03036]
    114154145 (mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114154145 (mapk1)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114154145 (mapk1)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   114154145 (mapk1)
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     114154145 (mapk1)
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114154145 (mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 114154145
NCBI-ProteinID: XP_027888775
LinkDB
Position
12
AA seq 364 aa
MATACPAGSSPGPGTELIRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDRDNKLRVAIKKI
SPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPSIEQMKDVYIVQDLMETDLYKLL
KTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADP
DHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQ
LNHILGILGSPSQEDLNCIINLKARNYLLSLPVRCKVPWNRLFPNADSKALDLLDRMLTF
NPHKRIEVEEALAHPYLEQYYDPTDEPTAEAPFKFDMELDDLPKETLKELIFEETARFQP
GFRS
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcgacagcttgccctgctggctccagccccggaccgggaacggagctcatccgcgga
caggccttcgacgtcgggcctcggtacagcaacctctcctacatcggggagggcgcctac
gggatggtgtgctctgcttatgaccgggacaacaagctccgcgtggccatcaaaaagatc
agcccgtttgagcaccagacctactgccagcgcaccctgagagaaatcaaaatcctgctg
cgcttcaagcacgagaacatcatcggcatcaacgacatcatccgggcgccgtccatcgag
cagatgaaggacgtatacatcgtccaggatctcatggagacagacctctacaagctcctg
aagacccaacacctgagcaacgaccacatctgctacttcctctaccagatcctccgaggg
ctcaagtacatccactctgccaacgtgctgcaccgcgacctgaagccctccaacctcctc
ctcaacaccacctgcgatctcaagatctgtgacttcggtctggctcgcgtggcggatcct
gaccacgaccacaccggcttcctaacagagtatgtcgccacgcgttggtacagagctcca
gagatcatgctcaactccaagggctacaccaagtccatagacatctggtcggtgggctgc
atcctggctgagatgctgtcaaacaggccaatcttcccagggaagcactacctggatcag
ctcaaccacattctggggattctgggctcccccagccaggaagacctcaactgcatcatc
aacctcaaggccaggaactacctgctgtcgctgccggtgcgctgcaaagtgccgtggaac
cgcctgttccccaacgccgacagtaaagctctggaccttctggacagaatgctgaccttt
aaccctcacaagaggatcgaggtggaggaggccctggcccacccttacctggagcaatat
tacgacccgacggacgagcccaccgccgaggctccgttcaagttcgacatggagctggac
gacctgcccaaagagacgctgaaggagctcatcttcgaagaaacggctcggttccagccc
ggcttcaggtcctaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114160039
Entry
114160039         CDS       T05908                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04114  Oocyte meiosis
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04261  Adrenergic signaling in cardiomyocytes
xco04270  Vascular smooth muscle contraction
xco04350  TGF-beta signaling pathway
xco04370  VEGF signaling pathway
xco04371  Apelin signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04540  Gap junction
xco04620  Toll-like receptor signaling pathway
xco04621  NOD-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04916  Melanogenesis
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114160039
   04012 ErbB signaling pathway
    114160039
   04350 TGF-beta signaling pathway
    114160039
   04370 VEGF signaling pathway
    114160039
   04371 Apelin signaling pathway
    114160039
   04068 FoxO signaling pathway
    114160039
   04150 mTOR signaling pathway
    114160039
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114160039
  09143 Cell growth and death
   04114 Oocyte meiosis
    114160039
   04210 Apoptosis
    114160039
   04218 Cellular senescence
    114160039
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114160039
   04520 Adherens junction
    114160039
   04540 Gap junction
    114160039
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114160039
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114160039
   04621 NOD-like receptor signaling pathway
    114160039
   04625 C-type lectin receptor signaling pathway
    114160039
  09152 Endocrine system
   04910 Insulin signaling pathway
    114160039
   04912 GnRH signaling pathway
    114160039
   04914 Progesterone-mediated oocyte maturation
    114160039
   04916 Melanogenesis
    114160039
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114160039
   04270 Vascular smooth muscle contraction
    114160039
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114160039
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114160039
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xco03036]
    114160039
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114160039
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114160039
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   114160039
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     114160039
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114160039
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 114160039
NCBI-ProteinID: XP_027898195
LinkDB
Position
16
AA seq 515 aa
MADSCGDMPVKAENSECAEIVVDTTEPSKAISTGAGLGSGSGPCPSSDPAPGSDIGSDPR
PGLDPDPEAAPKLIPMSVSKPKEAAAPGSGAVSGSDSSLGADSGSAEPMTVSEFEEAAAA
APRTEPGHARNPGHVPGSGRAPCADSVPMAISGPEEAAPPPRLPKTDVELVKGQAFDVGP
RYTNLAYIGEGAYGMVCSAQDNWTQQRVAIKKISPFEHQTYCQRTLREIKILLRFRHENI
IGINDIIRAPQLENMRDVYIVQTLMETDLYKLLKTQKLSNEHVCYFLYQILRGLKYIHSA
NVLHRDLKPSNLLINTTCDLKICDFGLARIADPVHDHTGFLTEYVATRWYRAPEIMLNSK
GYSKSIDMWSVGCILAEMLSNKPIFPGKHYLDQLNHILGVLGSPSQEDLNCIINLKARNY
LQSLPPKTRIPWDRLFPKADPKALDLLGCMLTFNPNKRITVEDALAHPYLEQYYDPTDEP
EAETPFDFTTELDDLPKETLKEMIYDETARFQTMS
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggcggattcatgcggcgatatgcctgtcaaggccgagaactcggagtgcgctgaaata
gttgttgatacaactgagccgtcgaaagcgattagtactggtgctggtctcggctctggc
tctggtccttgccccagctctgaccctgcccctggctcagacatcggctctgacccccgt
cctggactcgaccccgaccctgaagctgcacctaaactcatccccatgtctgtatccaaa
ccgaaggaagcagcggcccctggttctggcgctgtctccggttctgactcttctcttggc
gccgattctggctcagcagaacccatgactgtgtccgagtttgaggaggcagcggccgct
gctcccaggactgaacctggtcatgctcgcaaccccggccatgtccctggttctggtcgt
gccccctgcgccgactctgtccccatggcgatctctggaccggaggaggctgcgccccca
cctcggttgcccaaaacagacgtggagctggtgaagggacaggcatttgacgttggaccc
cgctacaccaacctggcttacatcggggagggagcgtacgggatggtgtgttcagctcag
gacaactggacccaacagcgggtggccatcaagaaaatcagcccgtttgagcaccagacc
tactgccagcgcacgctgcgggagatcaagatcctgctgcgcttccgccacgagaacatc
atcgggatcaatgacatcatcagggcgccgcagttggagaacatgagagacgtctacatc
gtgcaaacgctgatggagacggacttgtacaagctcttgaagacccagaagctgagcaac
gagcatgtgtgctacttcctttaccagatcctgaggggtcttaagtacattcactctgcc
aatgtgctgcaccgggacctcaagccctccaacctgctcatcaacaccacctgcgacctc
aagatttgtgacttcggcctggctcggatagctgatccagttcacgaccacactggtttc
ctcaccgagtacgtagccacacgttggtacagagccccagaaatcatgctcaactcaaag
ggctactcaaagtctatcgacatgtggtctgtgggctgcatcctggctgagatgttgtcc
aacaaacccatctttcctgggaaacactacttggaccaactgaaccacatactgggcgta
cttgggtcaccatctcaagaagatctgaactgcataattaacctgaaggcgcggaactac
cttcaatccctgccccctaagaccaggattccctgggacagactctttccaaaggcagat
ccaaaagccttggacctgttgggttgcatgttgacatttaaccccaacaagcgcatcact
gttgaagatgccctggctcatccctacctggagcagtactacgaccccaccgatgagccc
gaagcggagacgccatttgacttcacaacagaactggacgatcttcccaaggagacactg
aaggaaatgatctatgatgaaacggctcgtttccagacgatgagctga

DBGET integrated database retrieval system