KEGG   Xiphophorus couchianus (Monterrey platyfish): 114154573Help
Entry
114154573         CDS       T05908                                 

Gene name
hsd17b4
Definition
(RefSeq) peroxisomal multifunctional enzyme type 2
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00120  Primary bile acid biosynthesis
xco01040  Biosynthesis of unsaturated fatty acids
xco01100  Metabolic pathways
xco01212  Fatty acid metabolism
xco04146  Peroxisome
Module
xco_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    114154573 (hsd17b4)
   01040 Biosynthesis of unsaturated fatty acids
    114154573 (hsd17b4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    114154573 (hsd17b4)
Enzymes [BR:xco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     114154573 (hsd17b4)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     114154573 (hsd17b4)
    4.2.1.119  enoyl-CoA hydratase 2
     114154573 (hsd17b4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short MaoC_dehydratas adh_short_C2 SCP2 KR MaoC_dehydrat_N Alkyl_sulf_C
Motif
Other DBs
NCBI-GeneID: 114154573
NCBI-ProteinID: XP_027889600
LinkDB All DBs
Position
12
AA seq 737 aa AA seqDB search
MSLSFEGRVALVTGAGGGLGKEYALAFASRGASVVVNDLGADTKGGGRSSAAADKVVEEI
RAKGGKAVANYDSVEDGEKLIQSALDAFGRIDVLVNNAGILRDRSFARTSDLDWDLIHRV
HLRGSFLVTRAAWNHMKKQNFGRIIMTASAAGIYGNFGQANYSAAKLGLLGLANTLAIEG
RKYNIHCNTIAPVAGSRLTETVMPPDLVASLKPEYVAPLVLWLCHEQCQENGGLFEAGAG
WIGKLRWERTEGRIVRQRNKPMTPEGVRDQWDAICDFENATKPANIQESLHSVVSVLSQV
ESDGEVGANPAAAAASGATGSGFNPADAIGQKLPSTSFSFTSNQCILYALGVGMSTKDPD
SLRFLYEGHQDFSCLPTFGVIPSQATIMGGGLSSIPGLSIDFTQVLHGEQYLELYKPLPT
SGTLTSETTVADILDKGSGAVILLDVNTYNGDELVCYNQFSVFVVGAGRFGGKRSSDKAK
APLPAPKRAPDAVVIESTTRDQAALYRLSGDWNPLHIDPDFAAMGGFRAPILHGLCSFGF
AARHVLKRFADNDPAKFKAIKVRFAKPVFPGQSLQTEMWKEGSRIHIQCKVKETGDVALA
GGYVDLHGMSEASPEILPQGGGLQSDLVFAEIGRRVKGLGSELVKKVNAVFGWEITKDGE
KAAEWTIDLKNGSGSVLRGPPGGKVDVTFTLSDEDFMEVVTGKLQPQKAFFSGKLKVRGN
IMLSQKLEVILKDYAKL
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgtcattcgaaggaagagtggcgcttgtcactggcgctggaggaggtcttggc
aaagaatatgcactggccttcgcttcaagaggagcctctgtagttgtgaatgaccttggg
gcagacacaaaagggggtggaagaagttctgcagctgctgataaggtggtggaggagata
agagcaaaggggggcaaagctgtggcaaactatgattctgttgaagatggagagaagctg
atccaaagtgcccttgatgcctttggaagaattgatgttcttgtgaacaatgctggaata
cttcgtgaccgttcatttgccagaaccagcgatttggactgggaccttattcatagagtt
cacttaagagggtcgttcttggtaactcgagctgcctggaaccacatgaaaaaacaaaat
tttggcagaatcatcatgactgcgtcagctgcgggcatttatggtaacttcggccaggcc
aactacagcgctgccaagttaggcctgctggggctggctaacactttggccatcgaggga
cgcaagtacaacatccattgcaacacaatcgctcccgtggcggggtcccgcctcacggag
accgtcatgccgccagaccttgtggcgtctctgaagcctgagtatgtcgcccctctggtt
ctctggctctgtcatgaacaatgccaagaaaatggaggactgttcgaggctggagctggc
tggattggtaaattacgctgggagcgaactgagggccggatcgtgaggcagaggaacaaa
ccgatgactcctgagggggtccgggaccagtgggacgcgatctgtgattttgaaaatgcc
accaagccagctaatatacaagaatctctgcattcagttgtgagtgtgctgtctcaagtg
gagtcagatggagaagttggtgcaaatccagcagcagctgccgcctccggagcaacagga
tcagggtttaatcctgcggacgctatcggacaaaaactaccatcaacctcgttcagcttc
acctctaaccagtgtatcctctatgcgctgggagtcggcatgtccaccaaagatccggac
agcctcaggttcctgtacgaagggcatcaagacttcagctgcctccccacgttcggggtc
atcccctcgcaggccaccataatgggcggcggcctcagctccatccctggactcagcata
gacttcacacaggttttgcatggagagcagtatctggagctttacaaacctctgcctact
tcaggcacccttacctctgagactacagtggcagacattctagacaaaggatccggagcc
gtcatcctgctggacgtgaacacctacaacggcgacgagctcgtgtgctacaaccagttc
tcagtgtttgtggttggagccggacgcttcggaggaaagagaagctcagacaaagctaaa
gctcctctgcctgcacccaagcgcgcaccagatgctgtggtgattgaatcaaccacaaga
gaccaagccgccttgtaccgtctgagcggagactggaacccgctgcacatagaccccgac
ttcgccgccatgggaggcttcagggctcccatcctgcacggcttgtgttcgttcggcttc
gcggcgagacacgtcctcaagcgcttcgccgacaacgacccggcgaagttcaaggccata
aaggtccgctttgcgaagcccgtatttccgggtcagtcgctgcagaccgagatgtggaag
gagggcagccggatccacatccagtgtaaagtgaaggagacgggtgacgtcgctctggct
gggggctacgtggatttgcacggcatgtcagaagcttctcctgaaattctccctcaggga
ggaggcctgcagagcgacctggtgtttgcagagatcgggcggcgcgttaaaggcctgggc
tcagagctggtcaagaaggtgaacgccgtgttcggctgggagatcaccaaggacggcgag
aaagctgcagagtggaccattgatctgaagaacggcagcggctctgtgctcagagggccg
cccggcgggaaggtcgacgtgaccttcactctgtcagacgaggacttcatggaggtggtg
acggggaagcttcaacctcagaaggcgttcttctccggcaagctgaaggtgagagggaac
atcatgctgagtcagaagctggaggtcatcctgaaagactacgccaagctgtga

DBGET integrated database retrieval system