KEGG   Xiphophorus couchianus (Monterrey platyfish): 114155712
Entry
114155712         CDS       T05908                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114155712
   04068 FoxO signaling pathway
    114155712
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114155712
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114155712
NCBI-ProteinID: XP_027891547
LinkDB
Position
2
AA seq 194 aa
MKTGRSWLLEDSAVLGGKMSDVRLSNGSPTLERTEPRVTEHPKPPACRSLFGSVDHEELK
RDFKGHMRELQEAASAKWGFDFASDKPLPNARFTWELVDPAQVPDFYARPPRREKGVCSG
NNNVDLNGNHSCDSSMSDVLTECTEQCTGLRKRPCHDTTAQSKRSRSSPDEVSCPALSHS
VEHTPRKSSPRRQT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgaaaaccggacgctcctggctgctcgaagattcagctgttttagggggtaaaatgtct
gacgttcgactttcaaacggaagcccgacgttggaacggacggagccccgggttacggaa
cacccgaagccgccagcctgccgaagcctcttcggctcggtggaccacgaagagttgaag
agggattttaagggacatatgcgggagctgcaggaggctgcgtccgccaagtggggcttc
gactttgccagtgacaagccgctgcctaacgccaggttcacatgggaactagtggacccc
gctcaggtcccggatttctacgcgcggcccccgcggagggagaaaggcgtctgctctggg
aataacaatgtggatctaaacgggaatcatagctgcgattcgagcatgtcggacgtactg
actgagtgtacggagcagtgcaccgggctgaggaagagaccgtgtcacgacaccacggcg
cagagtaagaggtcacgcagcagcccagatgaagttagttgtccagcgctgagccactct
gttgaacacacacccagaaagtccagtcccaggaggcaaacgtga

DBGET integrated database retrieval system