KEGG   Xiphophorus couchianus (Monterrey platyfish): 114155967
Entry
114155967         CDS       T05908                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114155967
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    114155967
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xco04052]
    114155967
Cytokines and growth factors [BR:xco04052]
 Growth factors
  Growth factors (RTK binding)
   114155967
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 114155967
NCBI-ProteinID: XP_027891932
LinkDB
Position
2
AA seq 270 aa
MKKSKSWIDVCVHFLLFMTLGVHSAATGKVVNDIDRRVPDLRQNIPKDYKIPIKFIPKET
GDMCWAKLNLYYLEESLKDLSEKFGNISSNKLNIQILIQFIEEKRIGISNMNPQMLEFEC
HYRVDKWETGKYFNFVEEVCNTADRERPEEECDPPPCPTTPIPTEKTISFQSTSGHDMSY
NIATKDITRSSGSSPSPLRQVVEKSLFSLLFVPLLALIFLLVWKVRSRRNVEHPRSNRGE
EEGFTEPHLMAPRQDGETSEKNALNLPAEV
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatagacgtctgtgtccatttcctgctgttcatgacgctt
ggggtacattcagctgcaactggaaaagtggtcaatgatattgacagaagagtccctgat
ttgagacaaaatattccaaaagattacaaaatccccatcaagttcattcccaaagaaacg
ggcgacatgtgttgggcaaagttaaacctttactacttggaggagagcttgaaggattta
tctgaaaagtttggaaacatttcatctaataagctcaacatacaaatactcatccaattc
attgaagagaagcggataggaatcagtaatatgaatccacaaatgttagagtttgagtgc
cactacagagtggataagtgggaaacaggcaaatactttaactttgtcgaggaggtgtgt
aacaccgcagacagagaaagacctgaagaggaatgtgatccacctccctgtcccaccaca
ccgataccaacagagaagacgatctcatttcagtccacgtcaggccatgacatgtcatac
aatatcgctactaaagacataacacgctcatcaggttcttcgccaagtccccttcgccag
gtggtagagaaaagccttttctccttactgtttgtcccactgctggccctaatcttcctg
cttgtgtggaaggtcaggtcaagaaggaacgtagagcatcctcggtcaaatcgtggagaa
gaagaaggctttacagaaccacatctgatggcacctcggcaggacggtgaaacgtcagaa
aaaaatgcgctgaacctccccgcagaagtgtaa

DBGET integrated database retrieval system