KEGG   Xiphophorus couchianus (Monterrey platyfish): 114157111
Entry
114157111         CDS       T05908                                 

Gene name
pdpk1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco03320  PPAR signaling pathway
xco04068  FoxO signaling pathway
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04510  Focal adhesion
xco04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114157111 (pdpk1)
   04150 mTOR signaling pathway
    114157111 (pdpk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114157111 (pdpk1)
  09143 Cell growth and death
   04210 Apoptosis
    114157111 (pdpk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114157111 (pdpk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114157111 (pdpk1)
   03320 PPAR signaling pathway
    114157111 (pdpk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114157111 (pdpk1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114157111 (pdpk1)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114157111 (pdpk1)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   114157111 (pdpk1)
Membrane trafficking [BR:xco04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    114157111 (pdpk1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal FTA2 APH Kdo
Other DBs
NCBI-GeneID: 114157111
NCBI-ProteinID: XP_027893708
LinkDB
Position
2
AA seq 565 aa
MARATSQMYDVVPIQPNVAICSCSHPSMARNHPDSCSPLSIPSTSSSHCPNMEGSSPQPC
AVGAPSGSQSADGHAQPAAQTLQPRKKKPEDFKFGKILGEGSFSTVVLARELATAKEYAI
KILEKRHIMKENKVQYVKRERDLMSNLEHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKY
IRKIGSFDETCTRFYSAEIVCALEYLHKKGIIHRDLKPENILLNEEMHIQITDFGTAKQL
SSDSKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLI
FQKIIKLEYEFPEKFFPKAKDLVEQLLSLDPSKRLGCEEMGGYDPLRQHPFFDTISWSDL
HLQTPPKLTPYLPAMSEDDEDCYGNYDDLLSQFSNMQVAPSSSSHSLSPHDSAPPQRSSS
NIEQYIHDLDNNSFELDLLFTEEEKKLLLDKQTNGNPWHQFVENNLILKMGPVDKRKGLF
ARRRQLLLTEGPHLYYVDPVNRVLKGEIPWSSELRPEAKNFKTFFVHTPNRTYYLMDPSG
NADRWCKKIQEVWRKIYQRHQNPGL
NT seq 1698 nt   +upstreamnt  +downstreamnt
atggcaagagctacaagtcagatgtatgatgttgtgcccattcagcccaacgttgccatc
tgttcctgctcacatccatcaatggccagaaaccaccctgactcctgttcgccactctcc
atcccgagcacaagcagcagtcactgccccaacatggagggctcatccccgcagccctgc
gccgtaggagcgcccagcggctcccagagcgccgacggccacgcgcagccggccgcccag
acactgcagccacgcaagaagaagcccgaggacttcaagtttggcaagattctgggagag
ggctccttctcaacggttgttcttgcaagagagttggccacagcgaaagaatatgcaatt
aagattttagagaagcgccacattatgaaggagaacaaagtccagtacgtgaaaagagaa
cgagatttgatgtcaaatcttgaacacccgttctttgtaaagctctacttcacatttcaa
gacgatgagaagttgtattttggtcttagctatgctaagaacggggaactgctaaaatac
attcgcaaaattggttcgtttgatgagacctgtacacggttctactcagccgaaatagtt
tgtgctctagaatatttacacaaaaaggggataattcacagagatttgaaaccagaaaat
attcttttgaatgaggagatgcacatccagataacagattttggaacagcgaaacagtta
tcgtctgacagtaaacaagcaagagcaaactcctttgttgggacagcgcagtacgtgtct
ccagagctgctaacagaaaaatcagcctgcaagagctctgatctgtgggctttggggtgt
attatctatcagctggtagctggtttaccaccattcagagctggaaacgagtacctaata
ttccagaaaataataaagttggagtatgagttcccagaaaaattcttccccaaagccaag
gatctagttgagcaacttctgtcactggacccatccaagcggctcggatgtgaagagatg
ggagggtacgacccgctgaggcagcatcccttcttcgacaccatttcctggagtgactta
cacctgcagacgcccccaaagctcacaccttacctgccagcgatgtctgaagacgatgag
gactgctacgggaattacgatgacctcctgagccagttcagcaacatgcaggtggcgccg
tcgagctcgtcgcattccctgtcgccgcacgactcggcgccgccgcagcgatcaagcagc
aacatcgagcagtacatccatgacctggacaacaactcgtttgagctggaccttctgttc
actgaggaagaaaagaaattattgctggacaagcagaccaatgggaacccttggcatcag
tttgtggagaataatctgatcctgaagatgggaccagtggataaacgcaagggcctgttc
gcccgccggaggcagctgctgctgactgaagggccacacctgtactacgtggatcccgtc
aaccgggtcctgaagggggagatcccctggtcctccgagctgcgccccgaggccaaaaac
ttcaaaaccttcttcgttcacacgccgaaccggacgtactacctgatggaccccagcgga
aacgccgaccggtggtgcaagaagatccaggaagtgtggagaaagatctaccagaggcac
caaaacccaggcctatag

DBGET integrated database retrieval system