KEGG   Xiphophorus couchianus (Monterrey platyfish): 114157385Help
Entry
114157385         CDS       T05908                                 

Definition
(RefSeq) tetraspanin-5-like isoform X1
  KO
K17345  tetraspanin-5
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114157385
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114157385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin DUF3883
Motif
Other DBs
NCBI-GeneID: 114157385
NCBI-ProteinID: XP_027894110
LinkDB All DBs
Position
14
AA seq 271 aa AA seqDB search
MSGNHFKGHEVSCCIKYFIFGFNILFWLLGMTLVGIGLWAWSEKGVLSNISSITDLGGLD
PVWLFMVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTTGVLAFVFKDWIK
DQLNLFINNNIRAYRDDIDLQNLIDFTQEYWECCGAFGADDWNLNIYFNCTDGNPSREKC
GVPFSCCTKDPAEDVINTQCGYDIRAKPDSEQKDYINVKGCVPQFERWLQDNLTLVAGIF
IGVALLQIFGICLAQNLVSDIEAVRASCFFT
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggaatcatttcaaaggtcacgaagtcagttgctgcatcaaatacttcattttt
ggcttcaacatcctgttctggctgctgggcatgaccctagtagggattggactgtgggca
tggagtgagaagggggtcctgtccaacatctcgtccatcaccgacctggggggtcttgac
cctgtgtggctcttcatggtagttggaggggttatgttcattctgggctttgccggctgc
attggagctcttcgggaaaatacatttttgcttaagtttttctccgtgtttctgggaatc
atctttttcctggagttgacaacaggagttctggcctttgtttttaaggactggattaag
gaccaactcaacctattcatcaacaacaacatccgggcatatagggacgacatcgaccta
cagaacctcattgatttcactcaggaatattgggagtgctgtggcgcattcggagcagac
gactggaacctgaacatttactttaattgcactgatggaaatcccagtcgggaaaaatgt
ggggttcccttctcctgctgcaccaaggaccctgcggaggatgtgataaacactcagtgt
ggctatgacatcagagcaaaaccagactcggagcagaaggactacatcaatgtgaaaggc
tgcgttcctcagtttgagaggtggctccaggataacctcaccttggtggctgggatcttc
attggagtggcactattgcagatttttgggatttgtttggcccagaacttagtgagtgac
atcgaggcagtgagggcaagctgcttctttacctaa

DBGET integrated database retrieval system