KEGG   Xiphophorus couchianus (Monterrey platyfish): 114157395
Entry
114157395         CDS       T05908                                 

Definition
(RefSeq) transcription factor p65-like isoform X1
  KO
K04735  transcription factor p65
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04137  Mitophagy - animal
xco04210  Apoptosis
xco04218  Cellular senescence
xco04620  Toll-like receptor signaling pathway
xco04621  NOD-like receptor signaling pathway
xco04622  RIG-I-like receptor signaling pathway
xco04623  Cytosolic DNA-sensing pathway
xco04625  C-type lectin receptor signaling pathway
xco04920  Adipocytokine signaling pathway
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114157395
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    114157395
  09143 Cell growth and death
   04210 Apoptosis
    114157395
   04218 Cellular senescence
    114157395
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114157395
   04621 NOD-like receptor signaling pathway
    114157395
   04622 RIG-I-like receptor signaling pathway
    114157395
   04623 Cytosolic DNA-sensing pathway
    114157395
   04625 C-type lectin receptor signaling pathway
    114157395
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114157395
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114157395
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114157395
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xco03000]
    114157395
Transcription factors [BR:xco03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    114157395
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 114157395
NCBI-ProteinID: XP_027894126
LinkDB
Position
14
AA seq 629 aa
MDGVYGWGMTPINPVQPATPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTYP
AIKVHNYSGPLRVRISLVTKNPPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTSNNPFSIPEPKVWEEEFDLNSVRLCFQASITLPTGDMFPLPPVV
SQPIFDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFYQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLSEPIKVKMQLRRPSDREVSEPMDFQFLPADPDEYRLS
EKRKRTGDMFQNLKLGSMLSTVSVPQDRRHINLARRPVAAKLSSMNTQAAAEVAPSASGL
KPFSYNQPGQLFSVQPKVEASSSISTATTNQTWKIMESLKLGPTNPVQTFTMSSVSAPSS
STASTAANNEYSTVNLSDLHEFFPNISSPMAEESAAPQGSAAAPQTGSTFPLQESQFRVD
PPLVDDEIPDFSNFTDAPVPGTLDSLNMDEFEDLLNPRLMSEGGSAASMLTSSQHGVLSS
SAAASHNGASSQNLPDHVNNPGSTYMNYPNSIANLLRNEDMIILASSTNNNQQPAVLDDF
DVLMSADEDRLISIFNSGSQAGFVSGHPT
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggacggtgtgtacggatggggcatgacccctattaacccagtccaaccagcgacccct
tacatagagatcatcgagcagccgaagcagagggggatgaggttccgctataaatgtgag
ggtcgctcagctggcagcattcctggagagaaaagcaacgacaccactaagacctacccg
gccatcaaggttcacaactacagcggcccgctccgggtccgcatctccctggtgacaaag
aaccctccgcacaagccccacccccacgaactggttgggaaagactgcaaacatggctac
tatgaggccgacctgcaggagagacgaatccacagttttcagaacctgggcattcagtgt
gtgaagaagaaggatgtcaacgaggccatcacttgcagactgcagaccagcaacaacccc
ttcagcattcctgagcccaaggtgtgggaggaagagtttgacctgaattctgtgcgactt
tgcttccaggcgtccatcacccttcccacgggggacatgtttcctctgccgcccgtcgtc
tcgcagcccatctttgacaacagagccccgaacacagccgagttgaaaatctgcagagtg
aaccgtaactccggcagctgcagaggaggggatgaaatcttcctcctctgcgataaagtg
caaaaagaggacatcgaggtgcggttctaccaggactcctgggaggggaagggcacgttc
tctcaggctgacgtccaccggcaggtggccattgtgttccgcacgcctccctatcgcgac
actaacctcagcgagcccatcaaggtgaagatgcagctcagacggccctctgaccgtgaa
gtcagcgagccgatggacttccagttcctacctgctgacccagatgaatacaggctgtct
gagaagagaaagcgtacaggagacatgttccagaacttgaagctgggatctatgttatca
actgtgtccgttccacaagacagacgccacataaacctcgcacggagaccagttgcagct
aaactgagttcaatgaacacacaagcagcagcggaggttgcgccttctgccagtgggttg
aaaccgttctcatacaatcaaccaggacagctgttctcagtccagcctaaggttgaggca
tcttcgtccatctctacggcgactaccaaccaaacctggaagatcatggagagcttgaag
ctgggccccaccaacccggtgcagaccttcacaatgagctccgtatcggccccttcctcc
tccaccgcctccaccgctgccaacaacgagtactccaccgtcaacctgtcggaccttcac
gagttcttccccaacatttcctcccccatggccgaggagtccgcggctcctcagggaagc
gccgccgccccacagactggcagcaccttccccctgcaggagtcccagttccgggtagac
cccccgctggtggacgacgagatcccggacttctccaacttcaccgacgctccggtgcca
ggcaccctggacagcctcaacatggatgaattcgaggaccttctgaacccgcgcctaatg
agcgagggcggatctgccgcgtccatgctgacatcttcccaacatggagtcctctccagc
tcggctgctgcgtcccacaacggcgcctcgtcccagaacctcccagaccatgtcaacaac
ccaggaagcacctacatgaattaccccaacagcatcgccaacctgctccggaacgaggac
atgatcatcctggcgtccagcaccaacaacaaccagcagcccgccgtgctggatgacttc
gacgtgctgatgtccgccgacgaagaccgcctcatctccatttttaacagcgggagccaa
gctggctttgtgtcaggacacccaacttaa

DBGET integrated database retrieval system