KEGG   Xiphophorus couchianus (Monterrey platyfish): 114157548
Entry
114157548         CDS       T05908                                 

Gene name
bad
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X1
  KO
K02158  Bcl-2-antagonist of cell death
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04140  Autophagy - animal
xco04210  Apoptosis
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04910  Insulin signaling pathway
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114157548 (bad)
   04370 VEGF signaling pathway
    114157548 (bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114157548 (bad)
  09143 Cell growth and death
   04210 Apoptosis
    114157548 (bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114157548 (bad)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114157548 (bad)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114157548 (bad)
SSDB
Motif
Pfam: Bcl-2_BAD
Other DBs
NCBI-GeneID: 114157548
NCBI-ProteinID: XP_027894409
LinkDB
Position
14
AA seq 166 aa
MDTKFTISDGESDPSEDVEERGDLQLMQEKEKPLSQRHTLTLPELRSTTGRVRLNSESIA
STISREVELQARGEEEVGTPTEGFPFRGRSLSAPPSLWAAKKYGRQLRRMSDEFVNLLDK
GEMRNVSSDGSNRPIHHSRSWWSYLFSHQETEGENNHHENHASRTE
NT seq 501 nt   +upstreamnt  +downstreamnt
atggacacaaaatttacaatttcagacggtgagtcggacccatcggaagacgtagaggaa
agaggagacttgcagctaatgcaagaaaaggagaagccgctcagtcaacgccacaccctc
acgcttcctgagctccgatctacaacaggtcgggtgagactgaactcggagtccatcgct
tccaccatctccagagaggtggagctgcaggccaggggggaagaggaggtcgggaccccc
actgagggctttccattcaggggccgatctttatcagctcctccctccctgtgggctgcc
aagaagtacggccggcagcttcggaggatgagcgatgagtttgtcaacctgcttgataaa
ggggaaatgaggaatgtgagcagtgatgggtcgaacagaccgattcaccactccaggagc
tggtggagctacctcttcagtcaccaggagacagagggagagaacaaccaccacgaaaac
cacgcctcccgcaccgagtag

DBGET integrated database retrieval system