KEGG   Xiphophorus couchianus (Monterrey platyfish): 114158019
Entry
114158019         CDS       T05908                                 

Gene name
epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114158019 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xco04052]
    114158019 (epo)
Cytokines and growth factors [BR:xco04052]
 Cytokines
  CSF and other factors
   114158019 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 114158019
NCBI-ProteinID: XP_027895127
LinkDB
Position
14
AA seq 185 aa
MLRKTCRGLFALLLLVLEWTRPGLPSPLRPICDLRVLNHFIQEARDAEVAMKSCREGCGL
TEAVSVPQTTVNFDDWEKKNAMEQAQEVQTGLWLLQQALSLLRTSMTNSELNSHIDNVIR
NLHSITAVLRSLNFQEYTPPASTVGPEGTWRVSTATELLQVHLNFLRGKVRLLLLDAQAC
QQEAS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttgcggaaaacttgtagaggactgttcgccttgctgctattagtgttggagtggacc
cgtccaggcctaccgtccccactaaggccaatctgtgacctcagggtcctgaaccatttc
attcaggaagcacgagacgcagaagtcgctatgaaatcatgcagagaaggatgtggtctg
acagaggctgtctctgttccccaaactacggtcaactttgatgactgggaaaagaaaaat
gcaatggagcaagctcaggaagtgcagactggattgtggcttttacaacaggccctcagc
ttactacggacatcgatgacgaactcagaacttaatagccacatagacaacgtcatcaga
aacctacacagcatcaccgctgtactacgaagcctcaactttcaagaatataccccacct
gctagtactgtgggaccggagggaacatggcgggtgtccacagctacagaactgcttcaa
gttcacctcaatttcctgcgaggcaaagtacgccttcttcttttggacgcacaggcttgt
cagcaagaagccagctga

DBGET integrated database retrieval system