KEGG   Xiphophorus couchianus (Monterrey platyfish): 114159944
Entry
114159944         CDS       T05908                                 

Gene name
mosmo
Definition
(RefSeq) modulator of smoothened protein
  KO
K23663  modulator of smoothened protein
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114159944 (mosmo)
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl Cyt_bd_oxida_I LtrA TctB DUF423 DUF998
Other DBs
NCBI-GeneID: 114159944
NCBI-ProteinID: XP_027898027
LinkDB
Position
16
AA seq 167 aa
MDKLTIISGCLFLAADIFAIASIANPDWINTGESTGALTVGLVRQCQTIHGRERTCIPPR
LPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG
FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggataaactgacgattatttcaggatgcctgtttctggctgcagatatctttgcaata
gccagcattgcaaacccagactggatcaacactggtgaatcaacaggcgcccttacggtc
ggtcttgtccggcagtgtcagaccatacacggacgagagcggacctgtatcccgccacga
ctgccccctgagtgggtcactacgctcttcttcatcatcatgggcatcatatccctcaca
gtcacctgcggactgctagttgcatcgcattggcgcagagaagccaccaaatatgcccgc
tggattgccttcactggcatgattctgttctgcatggcagcgctcatcttcccaataggc
ttctacatcaacgaggtgggaggtcagccatataagctgcccaacaacacggtggtgggc
tcctcgtacgtgctgtttgtcctctccatcttcttcaccatagtgggactgctgtttgca
ggaaaagtttgcctcccaggctga

DBGET integrated database retrieval system