KEGG   Xiphophorus couchianus (Monterrey platyfish): 114160045
Entry
114160045         CDS       T05908                                 

Gene name
grb2
Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04150  mTOR signaling pathway
xco04510  Focal adhesion
xco04540  Gap junction
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114160045 (grb2)
   04012 ErbB signaling pathway
    114160045 (grb2)
   04068 FoxO signaling pathway
    114160045 (grb2)
   04150 mTOR signaling pathway
    114160045 (grb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114160045 (grb2)
   04540 Gap junction
    114160045 (grb2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114160045 (grb2)
   04912 GnRH signaling pathway
    114160045 (grb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114160045 (grb2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:xco04990]
    114160045 (grb2)
Membrane trafficking [BR:xco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    114160045 (grb2)
Domain-containing proteins not elsewhere classified [BR:xco04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   114160045 (grb2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 SH2_2 SH3_4 hSH3 DUF5093
Other DBs
NCBI-GeneID: 114160045
NCBI-ProteinID: XP_027898208
LinkDB
Position
16
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGEVLKVLNEECDQNWYKAELNGKDGFIPKNYIEMKAHPW
FFGKIPRAKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRTTSVSRNQQIFLRDIEQITQHPTYVQALFDFDPQEEGELGFRRG
DFIQVLDNSDPNWWKGGCHGQTGMFPRNYVTPVNRNM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggccatcgccaaatacgactttaaagctactgccgacgacgagcttagtttcaaa
cgcggagaggtcctcaaggtgttaaatgaagagtgcgatcagaactggtataaagcagaa
ctaaatgggaaagatggattcattcccaagaattacatagagatgaaagcccatccgtgg
ttcttcgggaagattccccgcgccaaagcagaggagatgctaaacaaacagaggcacgac
ggggcttttctcatccgagagagcgagagtgcgccaggagacttctccctgtcggtgaag
tttggtaatgatgtccagcatttcaaggtccttcgtgacggggctgggaagtatttcctc
tgggtggtgaagttcaactcgctcaacgagctggtggattaccaccgcacgacttcagtc
tcccgcaatcagcaaatcttcctgcgagacatagagcagatcacccagcacccgacgtac
gtgcaagcgctcttcgacttcgacccgcaggaggaaggcgagctgggtttcagacgcggc
gacttcatccaagtcctggacaactccgaccccaactggtggaaaggaggctgccacggc
cagacgggcatgttcccccgcaactacgtcacgcctgttaatcggaacatgtaa

DBGET integrated database retrieval system