KEGG   Xiphophorus couchianus (Monterrey platyfish): 114160056
Entry
114160056         CDS       T05908                                 

Gene name
mgrn1
Definition
(RefSeq) E3 ubiquitin-protein ligase MGRN1 isoform X1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04120  Ubiquitin mediated proteolysis
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114160056 (mgrn1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114160056 (mgrn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xco04121]
    114160056 (mgrn1)
Enzymes [BR:xco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     114160056 (mgrn1)
Ubiquitin system [BR:xco04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    114160056 (mgrn1)
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2 zf-RING_11
Other DBs
NCBI-GeneID: 114160056
NCBI-ProteinID: XP_027898226
LinkDB
Position
16
AA seq 548 aa
MGSILSRRIAGVEDIDIQANSAYRFPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDL
NFLGNRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDSDTSVEDGGKPKVQYGV
EFTFDADARVAITLYCQAFEEFSNGMAMYSPKDPTMVSETVHYKRGVSQQFSMPSFKIDF
SEWKEEDLNFDLDRGVFPMVIQAVVDEGDDCLGHAHVLLAAFERHVDGSFSVKPLKQKQI
VDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSC
ADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQTMDHDEHSSSDSVPP
GFEPISLLEALNGLRSVSPPIPSAPLYDEINFSGSLGGDSRQLSSPEHLSDGNLQKGKVS
KSPDSTLRSPSSPIQEEDEEKLSEMSDAQPHTLLSSSPAPTDATATEDVAESLSPDDEDR
MPSGGDILQDCSSEHCSLTKAESDPAGDLSLPGSSDSTESLKSQSTNCSSQPLLCPTSSL
HMEDEHFN
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggggtccatcctgagtcgtaggattgctggtgttgaagacatcgatatccaggcaaat
tcggcctatcgatttcccccgaaatctgggaattacttcgccagccatttcttcatggga
ggagagaaatttgatactccacatccagagggctacctctttggggaaaacatggacctg
aattttcttggaaataggccagtgcagtttccatatgtgacacctgcaccccatgaacca
gtgaaaaccttgaggagtctggttaacatacggaaggactctctccgtttagtgaggtac
aaagacgactcggacacttcggtggaggatggcgggaaacccaaggtccagtacggcgtg
gagtttacctttgatgctgatgccagggtcgccataacactctactgccaggcgtttgag
gagttctccaatgggatggctatgtacagtccaaaagatccaaccatggtctctgagaca
gtgcactacaagcgtggggtgagccagcagttctccatgccgtccttcaaaatagatttc
agcgagtggaaagaggaagatctaaactttgatttggaccgaggagtgtttcctatggta
atccaagctgtggtcgatgaaggagatgattgtcttggacatgctcatgtgcttttggca
gcatttgaaagacatgttgacggcagtttctccgtcaagcctctgaagcagaagcaaatc
gtggaccgtgtcagctacctcctccaggaaatctatgggattgagaacaaaaacaaccaa
gagaccaagccatctgacgatgagaacagcgacaacagcaatgagtgtgtcgtctgtctg
tccgacctgagagacacactcatcctgccttgcagacacctgtgtctctgcaactcctgc
gcagacactctgcgctatcaggccaacaactgtcccatctgcaggctgccctttagagcc
ttgctgcagataagagccgtgaggaagaaacctggagctctctctcctgtgtccttcagt
cctgttctggctcaaactatggaccatgatgagcactcaagctccgactcggtcccgcct
ggtttcgaacccatctccctgctggaggcgctgaacggtctgcggtcggtgtctcccccc
atcccttctgcgccgctgtatgacgaaatcaacttctccgggagtctgggaggggacagc
cggcagctgagctctccggagcatttaagtgacggaaatcttcagaaaggaaaagtcagc
aagtcacctgacagcaccctgagatcgccatcctctcccatccaggaggaggatgaagag
aaactgtctgagatgtctgacgcgcagccacacacactactctccagcagccccgctccc
acagatgctacagccaccgaggatgtggcggaatctctttctccagacgacgaggacaga
atgccgtctggaggagacatcctgcaggactgcagcagtgagcactgcagcttgaccaaa
gcagaaagcgacccagcgggggatctgtctttgcctggttcgtcagactcgacggaaagt
ctaaaaagtcagagcacaaactgctccagccagcctctcctgtgtcccacaagcagcctt
catatggaagatgaacatttcaactga

DBGET integrated database retrieval system