KEGG   Xiphophorus couchianus (Monterrey platyfish): 114160541
Entry
114160541         CDS       T05908                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04080  Neuroactive ligand-receptor interaction
xco04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114160541
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114160541
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xco04030]
    114160541
G protein-coupled receptors [BR:xco04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    114160541
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 114160541
NCBI-ProteinID: XP_027898995
LinkDB
Position
16
AA seq 367 aa
MDIDNNTSNSCYSNQNVTFFYQQVNKTIRGNWTTRDHLVIGLGLPLSLIVVLANLLVMAA
IHMNRRFHFPIYYLLGNMAAADLFAGLAYTNLIFNTGPWTAKLTKKQWYIRGALIDISLT
ASVANLLAVAVERHQTIITMQLHSTMTKRRVVLLIISIWAVGIIMGLVPSLFWNCECDLA
DCSTVAPLYSRRFLIFWALLNLLTFFIMLGMYSHIFFHVKRQSRHTSQHASEARQQTVIN
LMKTISMVLGAFVICWTPGLIVLLLDGLQGKESNANKYEKYCLAIAECNSLVNPIIYSLR
DAEMRKTFKWILCCFCRREGCQPRETLSTEIDSPLKEKILSYKLEDPVLWKNPDRDSKDD
KWTDSVV
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggacattgacaataatacgtcgaacagctgctacagcaaccaaaacgtcaccttcttt
taccaacaggtgaataaaactatcagagggaactggactacaagggaccacctggtcata
ggactaggcttgcccttatccttaatagttgtgttggccaacctgttagtgatggcagcc
atccacatgaaccgccgctttcacttccctatttactacctgctgggaaacatggcagca
gcagacttgtttgcaggtttagcctataccaacctgatattcaacacgggaccctggaca
gcgaagctcactaagaagcagtggtacatccgtggggctttgattgacatcagcctgact
gcctccgttgccaacctcctggctgtggctgtggaacgccaccagaccatcatcactatg
cagctgcacagcaccatgaccaagaggcgcgtggtgctgctcatcatctccatctgggcc
gtagggatcatcatgggtctggtgccatcgctgttttggaactgtgaatgtgatctcgca
gactgctccactgttgctcccctctacagccgccgcttcttgattttctgggcacttctc
aacctgctcacctttttcattatgctgggcatgtactctcacatattctttcacgtgaaa
cgccagagtcgccacacttctcagcacgcctccgaggcacgacagcagacagtcatcaac
ctgatgaaaaccatttctatggttctgggtgcctttgtgatctgctggacacctggcctc
atcgttctcctcctggacgggctgcagggtaaagagagcaacgccaacaaatatgagaaa
tactgtttggcgatagcggagtgcaactctctggtcaatccgatcatttattccttacgt
gacgccgagatgcggaaaacgttcaagtggatcctttgctgtttttgtcgacgtgagggc
tgtcagccgagggagactctgtcaacagaaattgactctccattgaaggagaaaattcta
agctacaagttagaagatccggtcttgtggaagaatccggacagagacagtaaagatgac
aagtggacagactctgtggtatga

DBGET integrated database retrieval system