KEGG   Xiphophorus couchianus (Monterrey platyfish): 114160677
Entry
114160677         CDS       T05908                                 

Definition
(RefSeq) uncharacterized protein LOC114160677 isoform X1
  KO
K05461  KIT ligand
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114160677
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    114160677
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xco04052]
    114160677
Cytokines and growth factors [BR:xco04052]
 Growth factors
  Growth factors (RTK binding)
   114160677
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 114160677
NCBI-ProteinID: XP_027899164
LinkDB
Position
17
AA seq 253 aa
MRKKIISTTCVLLGLFSSLHLCSGKFGTPITDDVSKLSVLKQNIPSDYEIPVGYIPREVA
GTCWVVLNIYPLERSLEKLASMFGDMSSNRDDVNVFVTMLKSLRLTFDHEELETAMQVFQ
CHYREKSLLSGLYFDYIQDLLRAATQGTLSFSCKPQPCLNHPQTAEGQEESRKYRWLKSS
SLLLVLIPFTACIVLIVWQVKSGRNSTACNTSNGQTASPDLIPTVSISIPLQTLTHADDS
QPTGEAISEHESG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcatcagcacaacttgtgtcctcttgggtctgttttcaagtttgcat
ctctgctctgggaaatttggaacgccaataactgatgatgtgagcaagctgtctgtgttg
aagcagaatatcccctctgattatgagattcctgttggttacattcccagagaggtggct
ggcacgtgctgggtggttttaaacatctatcctttggagcgaagtcttgaaaagctggcc
agcatgttcggtgacatgtcatcaaacagagacgacgtcaacgtctttgtcacgatgctg
aagagtttacgcctcacctttgaccatgaagagctggaaacagcaatgcaggtcttccag
tgtcactatcgagagaagagcttactctctggactttactttgactacatccaagacctc
ttgcgtgcggccactcaaggaacattgagtttctcttgcaagccacagccatgccttaat
catccgcaaacagcagaaggtcaggaggagagtcgcaaatacagatggttaaagagcagc
tctttgctcttggtgctaatccccttcacagcctgtattgtgctgatagtctggcaggtt
aagtctgggaggaactcaacagcgtgcaacacttcaaatggccaaactgcatctcctgac
ctgatcccaactgtgtctatctccatcccacttcaaacgctcacccacgccgatgacagc
cagccaacgggggaggcaatctctgaacatgagagcggatga

DBGET integrated database retrieval system