KEGG   Xiphophorus couchianus (Monterrey platyfish): 114160844
Entry
114160844         CDS       T05908                                 

Gene name
smo
Definition
(RefSeq) smoothened homolog
  KO
K06226  smoothened
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114160844 (smo)
G protein-coupled receptors [BR:xco04030]
 Frizzled / Smoothened family
  114160844 (smo)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 114160844
NCBI-ProteinID: XP_027899507
LinkDB
Position
17
AA seq 811 aa
MSSQGRSPIVGMLCVWAAWLSGCRAVMAPNGTMFEDNCKKTSTCEVLKYNTCLGSPLPYT
HTSLILAEDSSSQEEAFEKLTMWSGLRNAPRCWSVIQPLLCAVYMPKCENGRVELPSKSL
CLATRRPCSIVDRERGWPNFLKCDKFPVGCSNEVQKLKFNTSGQCEAPLVKTDIQSSWYK
DVEGCGIQCDNPLFTEEEHNDMHAYIAYFGTITLLCTFFTLATFLADWKNSNRYPAVILF
YINACFFVGSIGWLAQFLDGARKEIVCKSDNTMRLGEPSSSETLSCVTIFIIVYYSLMSG
VIWFVMLTYAWHTSFKALGTTHQPLSGRTSYFHMVTWSIPFVLTVAILAIAEVDGDSVSG
ICFVGYKNYHFRAGFVLAPIGVVLVVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINET
MLRLGIFGFLAFGFVLITFGCHFYDFFNQAEWERSFREYVLCEANVTIASQTNKPIPECT
IKNRPSLMVEKINLFSMFGTGIAMSTWVWTKATFLIWKRTWFKIIGRSDNEPKRIKKSKM
IAKAFAMRKELHKDPEKELSFSMHTVSHDGPVAGINFDLNEPSNDVSSAWALHVPKMVAR
RGAILPQDISVTPTGTPVPPPEERNRLWMVEADISPEMIKRKKKKKKRRKEVRNPDVVVE
NQTRLQREFGRSSVPRLPKLPCHPSLVANLREQQRQQTLEQGILPGSLPDYEPCEERCSY
LERRSSRNGYLMTRVDCPENLGLRPSCHPLTSNWQPSGSSMYPREVERTDGLSERMAHVA
RVPAGRRAGYGPIHSRTNLMEAELMDADSDF
NT seq 2436 nt   +upstreamnt  +downstreamnt
atgtcttcccagggtcggagccccattgttgggatgctttgcgtctgggctgcctggctg
tcgggctgcagggcagtgatggccccgaacgggactatgtttgaggacaactgcaagaaa
acctccacttgtgaggtgcttaaatacaacacatgtttgggttcacctttaccctacacc
catacatctctgatcctggcggaggactccagcagccaagaggaggcttttgagaagctg
accatgtggtctggattgcgaaacgccccacgttgctggtcagtcatccagccactgctc
tgtgccgtctacatgccgaaatgcgagaatggccgagtggagctgcccagcaagagcctg
tgtctggccacacgtcgcccatgcagcattgtggatcgggagagaggatggcccaatttc
ctcaaatgtgacaaatttcctgtgggctgttcgaatgaagtgcagaagctgaagttcaac
acgtcaggccagtgcgaagcccctctggtgaagacagacatacagtcgagttggtacaag
gatgtagaaggctgtggtatccagtgcgacaaccccttgttcaccgaagaggagcacaat
gacatgcacgcctacattgcttactttggcacaatcacactcctctgcacctttttcact
ctggccacatttcttgctgactggaaaaactcgaaccgctacccggctgtcattctcttc
tacatcaacgcctgcttctttgtgggcagcattggctggctcgcccagttcctggacgga
gcacgcaaagagattgtgtgcaagagtgacaacaccatgcggctcggggagccctcgtct
tcagaaacgctctcgtgcgtcaccatcttcatcatcgtctattactccttgatgtcaggc
gtgatttggttcgtcatgctgacctacgcctggcacacctccttcaaggctctgggtaca
actcaccagccactgtccggacggacctcctacttccacatggtgacctggtccattccc
tttgtcctcactgtggccatccttgctatagctgaggtggatggagactctgtgagtggg
atctgctttgtcggctacaagaactaccatttccgagccgggtttgtgctggcgcccatt
ggagtggtgcttgttgttggtggttactttctcattcggggtgtcatgaccttattttcc
atcaagagtaaccaccctggactactgagtgagaaagcagccagcaaaatcaatgagaca
atgctgagactaggtatatttggattccttgcctttggctttgttctcatcacattcgga
tgtcacttctatgacttcttcaaccaggctgaatgggagaggagcttcagagaatatgtg
ctatgtgaagccaacgtgacaatcgcctctcaaaccaacaagcccatcccagaatgcacc
attaaaaaccgtcccagcctgatggtggagaagatcaacctgttctccatgttcggcaca
ggaatcgccatgagcacctgggtctggaccaaagctaccttcctcatctggaaacgcact
tggttcaagatcattggtcgaagtgacaatgaacctaagaggataaagaagagcaagatg
attgctaaggcgttcgcaatgagaaaggagctccacaaggacccggagaaggagctgtcc
ttcagcatgcatactgtgtcacatgatggcccagtggctggaatcaattttgacctgaac
gagccgtcaaatgatgtttcatcagcatgggcgctccatgtacccaagatggtcgccaga
cggggagccattctgcctcaggacatttctgtcactcccactgggactccagtgccccct
ccagaggagaggaacagactgtggatggtggaggcagacatatcacctgagatgataaag
aggaaaaagaagaagaagaaaaggaggaaggaggtacgtaaccctgacgttgtggtggaa
aaccagactcgacttcagcgagagtttggccgcagctcagttcctcgcctgccgaaactt
ccctgccacccaagcctggtggccaatctgcgtgaacagcagaggcagcagacgctggag
cagggcatcctgccgggctcgttgccagattatgaaccctgcgaggaaaggtgttcatac
ttggagcgcaggagcagcagaaacggttacctgatgacccgagttgattgtccagaaaat
ctgggcctcaggccaagctgtcaccctttgacttcaaactggcagcccagtggatcgtca
atgtaccccagagaggtggagcgtactgacggactgtcagagagaatggctcatgtggct
cgggtaccggcgggccgcagggcaggctacggacccatccactccaggaccaatttaatg
gaggcggagcttatggatgctgactctgacttttaa

DBGET integrated database retrieval system