KEGG   Xiphophorus couchianus (Monterrey platyfish): 114161014
Entry
114161014         CDS       T05908                                 

Gene name
braf
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04150  mTOR signaling pathway
xco04270  Vascular smooth muscle contraction
xco04510  Focal adhesion
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114161014 (braf)
   04012 ErbB signaling pathway
    114161014 (braf)
   04068 FoxO signaling pathway
    114161014 (braf)
   04150 mTOR signaling pathway
    114161014 (braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114161014 (braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114161014 (braf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114161014 (braf)
   04914 Progesterone-mediated oocyte maturation
    114161014 (braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114161014 (braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114161014 (braf)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114161014 (braf)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   114161014 (braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 114161014
NCBI-ProteinID: XP_027899823
LinkDB
Position
17
AA seq 782 aa
MAALSSAESPPPVFNGDATEREPGRESGLEELGPGLDSSCSSGIPGGPQEEEIWNIKQMI
KLTQEHLEALLEKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEAMGNATDLSCTTS
PMSSLLEVKMGGDGVGGGAQALPSAPNSLAVLQTPTDTGRSNPRSPQKPIVRVFLPNKQR
TVVPARCGMTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEV
LENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQL
DLLLVSKFFEHHPFSQEEVSSEGTTPVSELCPSLPPSDSTGSIYHTTVSPSKSIPIPNSF
RTSEEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLICDQGLQRSDAGSTTGLSATPPAS
LPGSLTNVKAPQKSPCQQRERKSSSSSEDRNKMKTLGRRDSSDDWEIPEGQITLGQRIGS
GSFGTVFKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYTTKPQL
AIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLH
EDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRLQDKNPYSFQSDVYAFGIV
LYELMSGALPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMADCLKKKREERP
LFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYSCASPKTPIQAGGYGEFSA
FK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggcggcgttgagcagcgccgagtctccaccgcccgtcttcaacggagacgccacggag
cgggagccgggaagggagagcggcctggaggagctgggcccaggtttggactcttcgtgc
tcctcggggattcccggaggtccgcaggaggaagagatctggaacatcaagcagatgata
aagctgacacaggaacacttagaggctctgctggagaaatttggaggcgaacacaatcct
ccctccatatatttggaggcatatgaagagtacaccagtaaactggacgccctgcagcag
agggagcagcagctactggaagccatggggaatgccacagacctctcctgcaccacttcc
cctatgtcaagtctgttggaggtcaagatgggaggtgatggagttggaggtggagctcag
gctcttccctcagcccccaactcattagcagtcctgcagacccccaccgatactggacgg
tccaatccacgctccccccagaagcctattgttcgtgtgttcttgccaaacaaacagaga
acagtggtcccagcccgctgtgggatgactgtgagggactcactgaagaaagctctgatg
atgcggggactcatcccagagtgctgtgcagtctatagaatacaggatggagaaaagaag
cctattggctgggacacagacatctcctggctgactggagaggagctccacgtggaagtg
ttggagaatgtgccacttaccacacataactttgtgaggaagaccttcttcacattggcc
ttctgtgatttctgtagaaaactgctgttccagggttttcgctgtcagacctgtggctac
aagttccatcagcgctgcagcacagaggttcctctcatgtgtgtcaactatgaccagcta
gacttgctgcttgtatcaaagttcttcgagcatcatccgttcagccaggaagaggtctcc
tcagagggaaccacacctgtgtctgagctctgtccatctctccccccatcggactccacc
ggctctatataccacactacagtgtccccatccaagtccattcccattccaaatagtttt
cggaccagtgaggaagaccaccgcaaccagtttggccagcgagatcgttcgtcctccgcc
cccaatgtccatattaacaccattgagcctgtcaacattgatgatcttatctgtgatcag
ggcttgcagaggtcagatgcaggttctaccactgggctgtctgccacaccgccagcatct
cttcctggctcactgaccaatgtcaaagcaccacagaagtcaccatgccaacaaagggaa
cgcaagtcttcgtcatcgtctgaagatcgcaataaaatgaaaacactgggcagaagagac
tccagtgatgactgggagattccagaaggtcagatcaccctgggtcagaggataggctct
ggatcctttggaactgtctttaaaggaaaatggcatggtgatgtggctgtgaaaatgctg
aatgtcactgctcccactccacagcagcttcaggccttcaagaatgaagtgggcgtcctc
agaaaaacgcgtcatgtgaatatcttgctgttcatgggttacacaaccaaaccccagctg
gccattgtgacccagtggtgtgaaggctccagtctgtaccatcatctgcacatcattgaa
accaaatttgagatgatcaagctgatcgacatcgcccgtcagactgctcagggcatggat
tacctacatgccaagtccattattcacagagacctgaagagcaacaatattttcctgcat
gaggatctgaccgtgaagattggtgactttggtctagccacagtcaaatctcgttggagc
ggctcccaccagttcgagcaactgtctggttcaatactttggatggctccagaggtgatc
aggttgcaggacaagaatccctacagcttccagtcagatgtgtatgctttcggcattgtg
ctctatgagctcatgtcaggagctctgccctattccaacattaacaacagagaccagatt
atcttcatggtgggtcgaggttacctttctccagacctgagcaaggtccgcagcaactgt
cctaaggccatgaaaagactgatggcagattgcttgaagaaaaagagagaagagcgaccc
ctcttcccccagattttggcatccattgaactgctggctcgttcattacccaaaatccac
cgcagcgcctctgaaccttccttaaatcgagcaggctttcagacggaagacttcagcttg
tactcctgcgcctcacctaaaactcccattcaagctggaggttatggggagttttctgca
ttcaagtaa

DBGET integrated database retrieval system